Tyrosine Hydroxylase Antibody


Immunocytochemistry/ Immunofluorescence: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of mouse olfactory bulb shows immunoreactivity in the glomerular layer.
Immunocytochemistry/ Immunofluorescence: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of mouse hypothalamus shows immunoreactivity in a subset of neurons in the paraventricular nucleaus.
Western Blot: Tyrosine Hydroxylase Antibody [NBP2-38903] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2 : Human Adrenal Gland tissue.
Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of human cerebral cortex shows positivity in scattered neural fibers.
Immunocytochemistry/ Immunofluorescence: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of mouse hindbrain shows positivity in the locus coeruleus.
Immunocytochemistry/ Immunofluorescence: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of mouse Caudate putamen shows synaptic immunoreactivity.
Immunocytochemistry/ Immunofluorescence: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of mouse basal forebrain shows positivity in the core of nucleus accumbens.
Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of human lateral ventricle walls shows strong immunoreactivity in neural fibers.
Immunohistochemistry-Paraffin: Tyrosine Hydroxylase Antibody [NBP2-38903] - Staining of adrenal gland shows strong cytoplasmic positivity in medullary cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Tyrosine Hydroxylase Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
Specificity of human, mouse Tyrosine Hydroxylase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Tyrosine Hydroxylase Recombinant Protein Antigen (NBP2-38903PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Tyrosine Hydroxylase Antibody

  • DYT14
  • DYT5b
  • EC 1.14.16
  • EC
  • TH
  • TYH dystonia 14
  • TYH
  • Tyrosine 3-hydroxylase
  • tyrosine 3-monooxygenase
  • Tyrosine Hydroxylase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
Species: Hu, Mu, Rt, Ca, Eq
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS

Publications for Tyrosine Hydroxylase Antibody (NBP2-38903) (0)

There are no publications for Tyrosine Hydroxylase Antibody (NBP2-38903).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tyrosine Hydroxylase Antibody (NBP2-38903) (0)

There are no reviews for Tyrosine Hydroxylase Antibody (NBP2-38903). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tyrosine Hydroxylase Antibody (NBP2-38903) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Tyrosine Hydroxylase Antibody (NBP2-38903)

Discover related pathways, diseases and genes to Tyrosine Hydroxylase Antibody (NBP2-38903). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tyrosine Hydroxylase Antibody (NBP2-38903)

Discover more about diseases related to Tyrosine Hydroxylase Antibody (NBP2-38903).

Pathways for Tyrosine Hydroxylase Antibody (NBP2-38903)

View related products by pathway.

PTMs for Tyrosine Hydroxylase Antibody (NBP2-38903)

Learn more about PTMs related to Tyrosine Hydroxylase Antibody (NBP2-38903).

Research Areas for Tyrosine Hydroxylase Antibody (NBP2-38903)

Find related products by research area.

Blogs on Tyrosine Hydroxylase.

The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2
Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain.  Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa).  The importance of t...  Read full blog post.

Tyrosine hydroxylase - a marker for dopaminergic neurons in the central nervous system
Tyrosine hydroxylase is a member of the aromatic amino acid hydroxylase (AAAH) family.  It is expressed throughout the central nervous system (CNS) and catalyzes the conversion of tyrosine to L-3,4-dihydroxyphenylalanine (L-DOPA), which can be, thr...  Read full blog post.

Tyrosine Hydroxylase - rate-limiting enzyme in catecholamine synthesis
Catecholamines are tyrosine-derived hormones that are produced in the adrenal gland. They include epinephrine, norepinephrine, and dopamine and are used as neurotransmitters by the central and peripheral nervous system. The rate limiting enzyme in...  Read full blog post.

A Big Guy for the Catecholamine Synthesis - Tyrosine hydroxylase (TH)
In the synthesis pathway for the catecholamines - dopamine, epinephrine, and norepinephrine, tyrosine hydroxylase is the rate-limiting enzyme. Through alternative mRNA splicing, a wide molecular diversity of TH isoforms are generated that are tissue-s...  Read full blog post.

Tyrosine Hydroxylase Deficiencies and Neurodegeneration
Tyrosine hydroxylase is the rate-limiting enzyme in the synthesis pathway of the catecholamines dopamine, epinephrine, and norepinephrine. Alternative mRNA splicing generates a wide molecular diversity of TH isoforms that are tissue specific and produ...  Read full blog post.

Tyrosine Hydroxylase Deficiency and Brain Disorders
 Tyrosine hydroxylase catalyzes the rate-limiting step in the biosynthesis of the catecholamines dopamine, norepinephrine, and epinephrine. A hallmark of Parkinson's disease is the loss of dopaminergic neurons in the substantia nigra. Mutations in cas...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Tyrosine Hydroxylase Antibody and receive a gift card or discount.


Gene Symbol TH