Chromogranin C Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: NPVEEKIESQTQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SCG2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:5000 - 1:10000
- Immunohistochemistry-Paraffin 1:5000 - 1:10000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Chromogranin C Antibody - BSA Free
Background
Chromogranin C is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: IP, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC, IHC
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Publications for Chromogranin C Antibody (NBP2-62693) (0)
There are no publications for Chromogranin C Antibody (NBP2-62693).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Chromogranin C Antibody (NBP2-62693) (0)
There are no reviews for Chromogranin C Antibody (NBP2-62693).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Chromogranin C Antibody (NBP2-62693). (Showing 1 - 1 of 1 FAQ).
-
I need a Chromogranin C antibody to run some Western Blots on equine samples. Can you help me choose? I see two candidates on the website NBP1-56985 and NBP1-91628
- The two products for chromogranin C that are validated for equine samples on our site (NBP1-56985 and NBP1-91628) have been guaranteed based on homology. Below is the percent homology shared between the antibody immunogen and the horse protein sequence. NBP1-56985: immunogen is 100% homologous and NBP1-91628: immunogen is 92% homologous Based on this homology, NBP1-56985 will be your best choice. Since both products are covered by our guarantee, if you purchase either for use with your equine samples, and you are not able to detect the correct band, just contact us and we will see if there is any suggestion we can offer. If not, we can at that time offer a refund or replacement for your order.
Secondary Antibodies
| |
Isotype Controls
|
Additional Chromogranin C Products
Research Areas for Chromogranin C Antibody (NBP2-62693)
Find related products by research area.
|
Blogs on Chromogranin C