We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Chromogranin C Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693] - Staining of human cerebral cortex.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693] - Analysis in human adrenal gland and liver tissues using Anti-SCG2 antibody. Corresponding SCG2 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693] - Staining of human anterior pituitary gland shows strong cytoplasmic positivity in endocrine cells.
Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693] - Staining of human liver shows low expression as expected.
Independent Antibodies: Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693] - Staining of human adrenal gland, cerebral cortex, lymph node and pituitary gland using Anti-SCG2 antibody NBP2-62693 ...read more
Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693] - Staining of human lymph node.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Chromogranin C Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NPVEEKIESQTQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCG2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Chromogranin C Recombinant Protein Antigen (NBP2-62693PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Chromogranin C Antibody - BSA Free

  • CHCG
  • Chromogranin-C
  • EM66
  • SCG2
  • secretogranin IICHGCchromogranin-C
  • secretoneurin
  • SgIIsecretogranin-2
  • SN

Background

Chromogranin C is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-83299
Species: Hu
Applications: IHC,  IHC-P
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, ISH, WB
NBP1-83790
Species: Hu
Applications: IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: ICC/IF, IF, IHC,  IHC-P, MI, WB
NBP1-87581
Species: Hu
Applications: IHC,  IHC-P, WB
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80781
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB4077
Species: Hu
Applications: IHC, WB

Publications for Chromogranin C Antibody (NBP2-62693) (0)

There are no publications for Chromogranin C Antibody (NBP2-62693).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Chromogranin C Antibody (NBP2-62693) (0)

There are no reviews for Chromogranin C Antibody (NBP2-62693). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Chromogranin C Antibody (NBP2-62693). (Showing 1 - 1 of 1 FAQ).

  1. I need a Chromogranin C antibody to run some Western Blots on equine samples. Can you help me choose? I see two candidates on the website NBP1-56985 and NBP1-91628
    • The two products for chromogranin C that are validated for equine samples on our site (NBP1-56985 and NBP1-91628) have been guaranteed based on homology. Below is the percent homology shared between the antibody immunogen and the horse protein sequence. NBP1-56985: immunogen is 100% homologous and NBP1-91628: immunogen is 92% homologous Based on this homology, NBP1-56985 will be your best choice. Since both products are covered by our guarantee, if you purchase either for use with your equine samples, and you are not able to detect the correct band, just contact us and we will see if there is any suggestion we can offer. If not, we can at that time offer a refund or replacement for your order.

Secondary Antibodies

 

Isotype Controls

Additional Chromogranin C Products

Research Areas for Chromogranin C Antibody (NBP2-62693)

Find related products by research area.

Blogs on Chromogranin C

There are no specific blogs for Chromogranin C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Chromogranin C Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SCG2