Tyrosinase Antibody


Western Blot: Tyrosinase Antibody [NBP1-69516] - This Anti-Tyrosinase antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Tyrosinase Antibody Summary

Synthetic peptides corresponding to TYR(tyrosinase (oculocutaneous albinism IA)) The peptide sequence was selected from the middle region of Tyrosinase. Peptide sequence CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TYR and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Tyrosinase Antibody

  • CMM8
  • EC
  • LB24-AB
  • Monophenol monooxygenase
  • OCA1A
  • SHEP3
  • SK29-AB
  • Tumor rejection antigen AB
  • tyrosinase (oculocutaneous albinism IA)
  • tyrosinase


Tyrosinase is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. It catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for Tyrosinase Antibody (NBP1-69516) (0)

There are no publications for Tyrosinase Antibody (NBP1-69516).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tyrosinase Antibody (NBP1-69516) (0)

There are no reviews for Tyrosinase Antibody (NBP1-69516). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tyrosinase Antibody (NBP1-69516) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Tyrosinase Products

Bioinformatics Tool for Tyrosinase Antibody (NBP1-69516)

Discover related pathways, diseases and genes to Tyrosinase Antibody (NBP1-69516). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tyrosinase Antibody (NBP1-69516)

Discover more about diseases related to Tyrosinase Antibody (NBP1-69516).

Pathways for Tyrosinase Antibody (NBP1-69516)

View related products by pathway.

PTMs for Tyrosinase Antibody (NBP1-69516)

Learn more about PTMs related to Tyrosinase Antibody (NBP1-69516).

Research Areas for Tyrosinase Antibody (NBP1-69516)

Find related products by research area.

Blogs on Tyrosinase

There are no specific blogs for Tyrosinase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Tyrosinase Antibody and receive a gift card or discount.


Gene Symbol TYR