TRP2 Antibody - BSA Free

Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining in human skin and skeletal muscle tissues using anti-DCT antibody. Corresponding DCT RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human cerebral cortex, lymph node, skin and testis using Anti-TRP2 antibody NBP1-86892 (A) shows similar protein distribution across tissues to independent antibody NBP1-86893 (B).

Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - TRP2 immunoreactivity in equine skin. Tissue sections were incubated with primary antibody for 30 minutes at room temperature. IHC-P image submitted by a verified customer review.

Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skin shows strong cytoplasmic positivity in melanocytes.

Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human lymph node.

Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human testis.

Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skin.

Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - TRP2 immunoreactivity in canine skin. IHC-P image submitted by a verified customer review.

Analysis in human cell line SK-MEL-30 and human cell line U-2 OS.

• Reactivity: Hu, Ca, Eq
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRP2 Antibody - BSA Free (NBP1-86892) is a polyclonal antibody validated for use in IHC and WB. Anti-TRP2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNALEGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTDA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TRP2 Recombinant Protein Antigen (NBP1-86892PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%). Canine and equine reactivities reported from verified customer reviews.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TRP2 Antibody - BSA Free

• dopachrome delta-isomerase
• dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2)
• DT
• EC 5.3.3.12
• L-dopachrome tautomerase
• TRP2
• TRP-2
• Tyrosinase-related protein 2
• TYRP2
• TYRP2L-dopachrome Delta-isomerase

Background

TRP2 is involved in regulating eumelanin and phaeomelanin levels

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRP2 Antibody (NBP1-86892)(1)

Publication using NBP1-86892

• Ponten F, Jirstrom K, Uhlen M. The Human Protein Atlas--a tool for pathology. J Pathol 2008-12-01 [PMID: 18853439]

Reviews for TRP2 Antibody (NBP1-86892) (2)

Average Rating: 5

(Based on 2 reviews)

We have 2 reviews tested in 2 species: Canine, Equine.

reviewed by: Verified Customer IHC-P Equine 10/29/2021

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: skin
• Species: Equine
• Lot: A113741

Comments

• Comments: ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

reviewed by: Verified Customer IHC-P Canine 10/29/2021

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: skin
• Species: Canine
• Lot: A113741

Comments

• Comments: ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

Bioinformatics

• Gene Symbol: DCT