![Western Blot: TRP2 Antibody [NBP1-86892] - Analysis in human cell line SK-MEL-30 and human cell line U-2 OS.](http://images.novusbio.com/fullsize2/TRP2-Antibody-Western-Blot-NBP1-86892-img0013.jpg "Western Blot: TRP2 Antibody [NBP1-86892] - Analysis in human cell line SK-MEL-30 and human cell line U-2 OS.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNALEGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTDA |
| Specificity | Specificity of human TRP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DCT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-86892 | Applications | Species |
|---|---|---|
| Ponten F, Jirstrom K, Uhlen M et al. The Human Protein Atlas--a tool for pathology. J Pathol 2008 Dec [PMID: 18853439] |
Secondary Antibodies |
Isotype Controls |
Diseases for TRP2 Antibody (NBP1-86892)Discover more about diseases related to TRP2 Antibody (NBP1-86892).
| Pathways for TRP2 Antibody (NBP1-86892)View related products by pathway.
|
PTMs for TRP2 Antibody (NBP1-86892)Learn more about PTMs related to TRP2 Antibody (NBP1-86892).
| Research Areas for TRP2 Antibody (NBP1-86892)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DCT |
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skin.](http://images.novusbio.com/fullsize2/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0015.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skin.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skin shows strong cytoplasmic positivity in melanocytes.](http://images.novusbio.com/fullsize2/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0003.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skin shows strong cytoplasmic positivity in melanocytes.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize2/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0006.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining in human skin and skeletal muscle tissues using anti-DCT antibody. Corresponding DCT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0007.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining in human skin and skeletal muscle tissues using anti-DCT antibody. Corresponding DCT RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human lymph node.](http://images.novusbio.com/fullsize2/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0010.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize2/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0011.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human testis.](http://images.novusbio.com/fullsize2/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0012.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human testis.")
![Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human cerebral cortex, lymph node, skin and testis using Anti-TRP2 antibody NBP1-86892 (A) shows similar protein distribution across tissues to independent antibody NBP1-86893 (B).](http://images.novusbio.com/fullsize2/TRP2-Antibody-Immunohistochemistry-Paraffin-NBP1-86892-img0014.jpg "Immunohistochemistry-Paraffin: TRP2 Antibody [NBP1-86892] - Staining of human cerebral cortex, lymph node, skin and testis using Anti-TRP2 antibody NBP1-86892 (A) shows similar protein distribution across tissues to independent antibody NBP1-86893 (B).")
![Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in B16F1 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Tyrosinase Antibody (JA52-11)-Immunocytochemistry-Immunofluorescence-NBP2-67232-img0005.jpg)
![Immunohistochemistry-Paraffin: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Analysis of paraffin-embedded human stomach cancer tissue using anti-Tyrosinase antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/Tyrosinase-Antibody-(JA52-11)-Immunohistochemistry-Paraffin-NBP2-67232-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in A431 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Tyrosinase-Antibody-(JA52-11)-Immunocytochemistry-Immunofluorescence-NBP2-67232-img0001.jpg)
![Immunohistochemistry-Paraffin: TYRP1 Antibody [NBP1-88370] - Analysis in human skin and cerebral cortex tissues. Corresponding TYRP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/TYRP1-Antibody-Immunohistochemistry-Paraffin-NBP1-88370-img0012.jpg)
![Western Blot: TYRP1 Antibody [NBP1-88370] - Analysis in control (vector only transfected HEK293T lysate) and TYRP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/TYRP1-Antibody-Western-Blot-NBP1-88370-img0011.jpg)
![Immunocytochemistry/Immunofluorescence: TYRP1 Antibody [NBP1-88370] - Staining of human cell line SK-MEL-30 shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/images2/TYRP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88370-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat trigeminal at 1 : 500 dilution using Rabbit antibody to 2d extracellular loop of TRPC1: whole serum, DAPI counterstained appearing in blue.](http://images.novusbio.com/images2/TRP1 Antibody-Immunocytochemistry-Immunofluorescence-NB100-98844-img0018.jpg)
![Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat brain at 1:500 dilution using Rabbit antibody to 2d extracellular loop of TRPC1: whole serum, DAPI counterstained appearing in blue.](http://images.novusbio.com/images2/TRP1 Antibody-Immunocytochemistry-Immunofluorescence-NB100-98844-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: TRPC1 Antibody [NB100-98844] - IF (confocal) on rat olfactory bulb at 1:500 dilution using Rabbit antibody to TRPC1: whole serum, DAPI counterstained appearing in blue.](http://images.novusbio.com/images2/TRP1 Antibody-Immunocytochemistry-Immunofluorescence-NB100-98844-img0014.jpg)
![Western Blot: MITF Antibody (21D1418) [NB100-56561] - Analysis of A375 lysate using MITF antibody at 4 ug/ml.](http://images.novusbio.com/images2/MITF-Antibody-(21D1418)-Western-Blot-NB100-56561-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: MITF Antibody (21D1418) [NB100-56561] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-MITF Antibody (21D1418) NB100-56561 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution for 60 minutes. Cells were imaged using a 100X objective and digitally deconvolved.](http://images.novusbio.com/images2/MITF-Antibody-(21D1418)-Immunocytochemistry-Immunofluorescence-NB100-56561-img0008.jpg)
![Immunohistochemistry-Paraffin: MITF Antibody (21D1418) [NB100-56561] - Analysis of a FFPE tissue section of human skin using 1:200 dilution of MITF (21D1418) antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. General cytoplasmic staining appears enriched in melanocytes below the epidermis. Some nuclear reactivity is observed as well.](http://images.novusbio.com/images2/MITF-Antibody-(21D1418)-Immunohistochemistry-Paraffin-NB100-56561-img0007.jpg)
![Western Blot: PMEL17/SILV Antibody [NBP1-69571] - Sample Tissue: Human MCF7 Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/images2/PMEL17-SILV-Antibody-Western-Blot-NBP1-69571-img0006.jpg)
![Immunohistochemistry: PMEL17/SILV Antibody [NBP1-69571] - The inflammatory MITFlow/c-Junhigh cell state correlates with increased myeloid cell infiltration in human melanomas. Immunohistochemical analysis for gp100, CD45 and CD14 in representative cases from the Lund melanoma cohort. Small panels show zoom-in views, for example, to visualize morphology of CD45+/CD14+ tumour-infiltrating immune cells. Scale bars, 50 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/ncomms9755) licensed under a CC-BY licence.](http://images.novusbio.com/images2/PMEL17-SILV-Antibody-Immunohistochemistry-NBP1-69571-img0007.jpg)
![Western Blot: PMEL17/SILV Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.](http://images.novusbio.com/images2/PMEL17-SILV-Antibody-Western-Blot-NBP1-69571-img0003.jpg)
![Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate with antibody at 0.3 ug/mL (A) and Rat Brain cell lysate with antibody at 2 ug/mL (B). 35 ug protein in RIPA buffer. Detected by chemiluminescence.](http://images.novusbio.com/images2/POMC-Antibody-Western-Blot-NB100-1533-img0005.jpg)
![Immunohistochemistry: POMC Antibody [NB100-1533] - Representative confocal images of POMC in POMC-transfected WT and Sel1L-/- N2a cells. White arrows point to POMC-containing secretory granules, while yellow arrows point to perinuclear POMC. KDEL marks the ER. Representative data from at least 2 independent experiments are shown. Image collected and cropped by CiteAb from the following publication (jci.org/articles/view/96420), licensed under a CC-BY licence.](http://images.novusbio.com/images2/POMC-Antibody-Immunohistochemistry-NB100-1533-img0008.jpg)
![Flow Cytometry: POMC Antibody [NB100-1533] - Flow cytometric analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.](http://images.novusbio.com/images2/POMC-Antibody-Flow-Cytometry-NB100-1533-img0006.jpg)
![Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody (A19-P) [NBP1-30151] - Confocal microscopy image of human fetal inner ear tisue section stained with Melan-A antibody (green), 1:200 dilution, incubated over night. IHC-P image submitted by a verified customer review.](http://images.novusbio.com/images2/Melan-A-MART-1-Antibody-(A19-P)-Immunohistochemistry-Paraffin-NBP1-30151-img0012.jpg)
![Immunohistochemistry-Paraffin: Melan-A/MART-1 Antibody (A19-P) [NBP1-30151] - Human tissue (4 um section) stained with anti - Melan A monospecific clonal antibody.](http://images.novusbio.com/images2/Melan-A-MART-1-Antibody-(A19-P)-Immunohistochemistry-Paraffin-NBP1-30151-img0011.jpg)
![Western Blot: FACA/FANCA Antibody [NB100-2564] - Detection of FANC A in transfected COS1 cell lysate.](http://images.novusbio.com/images2/FACA-FANCA-Antibody-Western-Blot-NB100-2564-img0004.jpg)
![Western Blot: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Frataxin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Frataxin.](http://images.novusbio.com/images/Frataxin Antibody (1C12)-Western Blot-NBP2-01743-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Frataxin Antibody (1C12) [NBP2-01743] Staining of COS7 cells transiently transfected by pCMV6-ENTRY Frataxin.](http://images.novusbio.com/images/Frataxin Antibody (1C12)-Immunocytochemistry-Immunofluorescence-NBP2-01743-img0009.jpg)
![Immunohistochemistry-Paraffin: Frataxin Antibody (1C12) [NBP2-01743] - Staining of paraffin-embedded Human prostate tissue using anti-Frataxin mouse monoclonal antibody.](http://images.novusbio.com/images/Frataxin Antibody (1C12)-Immunohistochemistry-Paraffin-NBP2-01743-img0008.jpg)
![Western Blot: TBP like protein TLP Antibody [NBP1-31133] - Sample (30 ug of whole cell lysate) A: 293T 12% SDS PAGE, antibody diluted at 1:2000.](http://images.novusbio.com/images2/TBP like protein TLP Antibody-Western Blot-NBP1-31133-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: TBP like protein TLP Antibody [NBP1-31133] - NT2D1 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: TLP protein stained by TLP antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.](http://images.novusbio.com/images2/TBP-like-protein-TLP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31133-img0006.jpg)
![Immunohistochemistry-Paraffin: TBP like protein TLP Antibody [NBP1-31133] - Paraffin-embedded mouse lung. TLP antibody dilution: 1:500.](http://images.novusbio.com/images2/TBP-like-protein-TLP-Antibody-Immunohistochemistry-Paraffin-NBP1-31133-img0008.jpg)
![Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Wild-type (WT) and DLD knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.](http://images.novusbio.com/images2/Dihydrolipoamide-Dehydrogenase-DLD-Antibody-Western-Blot-NBP1-31302-img0014.jpg)
![Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.](http://images.novusbio.com/images2/Dihydrolipoamide-Dehydrogenase-DLD-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31302-img0013.jpg)
![Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Human gastric cancer, using DLD antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.](http://images.novusbio.com/images2/Dihydrolipoamide-Dehydrogenase-DLD-Antibody-Immunohistochemistry-Paraffin-NBP1-31302-img0008.jpg)
![Flow Cytometry: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.](http://images.novusbio.com/images2/CD8-Antibody-(53-6.7)-Flow-Cytometry-NBP1-49045-img0014.jpg)
![Immunohistochemistry-Paraffin: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - CD8 alpha expression in mouse spleen tissue using anti-CD8 alpha antibody. Image from verified customer review.](http://images.novusbio.com/images2/CD8-Antibody-(53-6.7)-Immunohistochemistry-Paraffin-NBP1-49045-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of bone marrow tissue by single and multiple staining.](http://images.novusbio.com/images2/CD8-Antibody-(53-6.7)-Immunocytochemistry-Immunofluorescence-NBP1-49045-img0006.jpg)
![Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.](http://images.novusbio.com/images2/Coagulation-Factor-II-Thrombin-Antibody-Western-Blot-NBP1-58268-img0007.jpg)
![Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.](http://images.novusbio.com/images2/Coagulation-Factor-II-Thrombin-Antibody-Immunohistochemistry-NBP1-58268-img0008.jpg)
![Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue](http://images.novusbio.com/images2/Coagulation-Factor-II-Thrombin-Antibody-Immunohistochemistry-Paraffin-NBP1-58268-img0005.jpg)
![Western Blot: RanBP2 Antibody [NB120-2938] - Effect of hypoxia on the interaction between HIF1alpha and BICD1. Co-immunoprecipitation of HIF1alpha, Dynein IC, Importin alpha3, RanBP2 with IgG and BICD1 antibodies were shown in left panel. Total protein expressions in lysate were shown in right panel. n = 3. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41418-018-0241-1) licensed under a CC-BY licence.](http://images.novusbio.com/images2/RanBP2-Antibody-Western-Blot-NB120-2938-img0003.jpg)
![Immunohistochemistry: RanBP2 Antibody [NB120-2938] - Figure 1 illustrates immunohistochemical staining of RanBP2 in bovine retina using NB120-2938. Figure 2 illustrates Western blot detection of RanBP2 from human retinal extracts using NB120-2938.](http://images.novusbio.com/images2/RanBP2-Antibody-Immunohistochemistry-NB120-2938-img0001.jpg)
![Western Blot: RanBP2 Antibody [NB120-2938] - Analysis of human retinal extracts.](http://images.novusbio.com/images2/RanBP2 Antibody-Western Blot-NB120-2938-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")