Tryptase gamma-1/TPSG1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Tryptase gamma-1/TPSG1 Antibody - BSA Free (NBP2-37977) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TPSG1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Tryptase gamma-1/TPSG1 Antibody - BSA Free
Background
Mast cells contain a number of preformed chemical mediators such as histamine, chymase, carboxypeptidase and proteolytic tryptase. Human Mast Cell Tryptase is considered to be an important marker of mast cell activation as well as an important mediator of inflammation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, mIF, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: ELISA, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC
Publications for Tryptase gamma-1/TPSG1 Antibody (NBP2-37977) (0)
There are no publications for Tryptase gamma-1/TPSG1 Antibody (NBP2-37977).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Tryptase gamma-1/TPSG1 Antibody (NBP2-37977) (0)
There are no reviews for Tryptase gamma-1/TPSG1 Antibody (NBP2-37977).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Tryptase gamma-1/TPSG1 Antibody (NBP2-37977) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Tryptase gamma-1/TPSG1 Products
Blogs on Tryptase gamma-1/TPSG1