Tryptase gamma-1/TPSG1 Antibody


Immunohistochemistry-Paraffin: Tryptase gamma-1/TPSG1 Antibody [NBP2-37977] - Staining of human liver shows low expression as expected.
Immunohistochemistry: Tryptase gamma-1/TPSG1 Antibody [NBP2-37977] - Staining of human stomach, lower shows strong cytoplasmic positivity in parietal cells.
Immunohistochemistry-Paraffin: Tryptase gamma-1/TPSG1 Antibody [NBP2-37977] - Staining of human colon shows high expression.
Immunohistochemistry-Paraffin: Tryptase gamma-1/TPSG1 Antibody [NBP2-37977] - Staining in human colon and liver tissues using anti-TPSG1 antibody. Corresponding TPSG1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Tryptase gamma-1/TPSG1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR
Specificity of human Tryptase gamma-1/TPSG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Tryptase gamma-1/TPSG1 Protein (NBP2-37977PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Tryptase gamma-1/TPSG1 Antibody

  • EC 3.4.21
  • EC 3.4.21.-
  • gamma I
  • gamma II
  • lung tryptase
  • mast cell protease II
  • mast cell tryptase
  • PRSS31skin tryptase
  • Serine protease 31
  • TMTpituitary tryptase
  • TPSG1
  • Transmembrane tryptase
  • trpA
  • tryptase gamma 1
  • tryptase gamma I
  • tryptase gamma II
  • tryptase gamma
  • Tryptase gamma1
  • Tryptase gamma-1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P

Publications for Tryptase gamma-1/TPSG1 Antibody (NBP2-37977) (0)

There are no publications for Tryptase gamma-1/TPSG1 Antibody (NBP2-37977).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptase gamma-1/TPSG1 Antibody (NBP2-37977) (0)

There are no reviews for Tryptase gamma-1/TPSG1 Antibody (NBP2-37977). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tryptase gamma-1/TPSG1 Antibody (NBP2-37977) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Tryptase gamma-1/TPSG1 Antibody (NBP2-37977)

Discover related pathways, diseases and genes to Tryptase gamma-1/TPSG1 Antibody (NBP2-37977). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Tryptase gamma-1/TPSG1

There are no specific blogs for Tryptase gamma-1/TPSG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Tryptase gamma-1/TPSG1 Antibody and receive a gift card or discount.


Gene Symbol TPSG1