RNASE3 Antibody - BSA Free

Immunohistochemistry-Paraffin: RNASE3 Antibody [NBP2-33778] - Analysis in human bone marrow and skeletal muscle tissues using NBP2-33778 antibody. Corresponding RNASE3 RNA-seq data are presented for the same tissues.

Western Blot: RNASE3 Antibody [NBP2-33778] - Analysis in human cell line U-937 MG.

Immunohistochemistry-Paraffin: RNASE3 Antibody [NBP2-33778] - Staining of human skeletal muscle shows no positicyt in myocytes as expected.

Immunohistochemistry-Paraffin: RNASE3 Antibody [NBP2-33778] - Staining of human bone marrow shows strong cytoplasmic positivyt in hematopoietic cells.

Immunohistochemistry-Paraffin: RNASE3 Antibody [NBP2-33778] - Staining of human duodenum shows strong cytoplasmic positivity in subset of lymphoid cells.

Immunohistochemistry-Paraffin: RNASE3 Antibody [NBP2-33778] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RNASE3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNASE3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RNASE3 Protein (NBP2-33778PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RNASE3 Antibody - BSA Free

• eosinophil cationic protein
• ECP
• ribonuclease, RNase A family, 3
• RNase3
• RNS3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNASE3 Antibody (NBP2-33778)(1)

Publication using NBP2-33778

• Giusti Delphine, Bini Estela, Terryn Christine et al. NET Formation in Bullous Pemphigoid Patients With Relapse Is Modulated by IL-17 and IL-23 Interplay. Frontiers in Microbiology 2019-04-04 [PMID: 31019514] (IHC-P, Human)

Bioinformatics

• Gene Symbol: RNASE3
• Uniprot:
  • P12724(Human)