RNASE3 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: RNASE3 Antibody [NBP2-33778] - Analysis in human bone marrow and skeletal muscle tissues using NBP2-33778 antibody. Corresponding RNASE3 RNA-seq data are ...read more
Western Blot: RNASE3 Antibody [NBP2-33778] - Analysis in human cell line U-937 MG.
Immunohistochemistry-Paraffin: RNASE3 Antibody [NBP2-33778] - Staining of human skeletal muscle shows no positicyt in myocytes as expected.
Immunohistochemistry-Paraffin: RNASE3 Antibody [NBP2-33778] - Staining of human bone marrow shows strong cytoplasmic positivyt in hematopoietic cells.
Immunohistochemistry-Paraffin: RNASE3 Antibody [NBP2-33778] - Staining of human duodenum shows strong cytoplasmic positivity in subset of lymphoid cells.
Immunohistochemistry-Paraffin: RNASE3 Antibody [NBP2-33778] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

RNASE3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: CGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNASE3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RNASE3 Protein (NBP2-33778PEP)
Publications
Read Publication using
NBP2-33778 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNASE3 Antibody

  • eosinophil cationic protein
  • ECP
  • ribonuclease, RNase A family, 3
  • RNase3
  • RNS3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNASE3 Antibody (NBP2-33778)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RNASE3 Antibody (NBP2-33778) (0)

There are no reviews for RNASE3 Antibody (NBP2-33778). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNASE3 Antibody (NBP2-33778) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNASE3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNASE3
Uniprot