Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVV |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | RNASE3 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP2-33778 | Applications | Species |
---|---|---|
Giusti Delphine, Bini Estela, Terryn Christine et al. NET Formation in Bullous Pemphigoid Patients With Relapse Is Modulated by IL-17 and IL-23 Interplay. Frontiers in Microbiology 2019-04-04 [PMID: 31019514] (IHC-P, Human) | IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for RNASE3 Antibody (NBP2-33778)Discover more about diseases related to RNASE3 Antibody (NBP2-33778).
| Pathways for RNASE3 Antibody (NBP2-33778)View related products by pathway.
|
PTMs for RNASE3 Antibody (NBP2-33778)Learn more about PTMs related to RNASE3 Antibody (NBP2-33778).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.