Cathepsin G Antibody

Images

 
Immunohistochemistry-Paraffin: Cathepsin G Antibody [NBP2-33498] - Staining of human rectum shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Cathepsin G Antibody [NBP2-33498] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: Cathepsin G Antibody [NBP2-33498] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Cathepsin G Antibody [NBP2-33498] - Staining in human bone marrow and cerebral cortex tissues using anti-CTSG antibody. Corresponding CTSG RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cathepsin G Antibody [NBP2-33498] - Analysis in human bone marrow and cerebral cortex tissues. Corresponding Cathepsin G RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: Cathepsin G Antibody [NBP2-33498] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Cathepsin G Antibody [NBP2-33498] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Cathepsin G Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFK
Specificity
Specificity of human Cathepsin G antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTSG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publications using
NBP2-33498 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cathepsin G Antibody

  • cathepsin G
  • CathepsinG
  • CGCATG
  • EC 3.4.21
  • EC 3.4.21.20
  • MGC23078

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-38770
Species: Hu, Mu
Applications: WB
7270-IL/CF
Species: Hu
NB600-930
Species: Hu, Rt
Applications: WB, ELISA
NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-75441
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Rb, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Cathepsin G Antibody (NBP2-33498)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Cathepsin G Antibody (NBP2-33498) (0)

There are no reviews for Cathepsin G Antibody (NBP2-33498). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cathepsin G Antibody (NBP2-33498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Cathepsin G Products

Bioinformatics Tool for Cathepsin G Antibody (NBP2-33498)

Discover related pathways, diseases and genes to Cathepsin G Antibody (NBP2-33498). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin G Antibody (NBP2-33498)

Discover more about diseases related to Cathepsin G Antibody (NBP2-33498).
 

Pathways for Cathepsin G Antibody (NBP2-33498)

View related products by pathway.

PTMs for Cathepsin G Antibody (NBP2-33498)

Learn more about PTMs related to Cathepsin G Antibody (NBP2-33498).

Blogs on Cathepsin G

There are no specific blogs for Cathepsin G, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSG
Uniprot
Novus 100% Guarantee