PAR2 Antibody (9X8E6)

Western Blot: PAR2 Antibody (9X8E6) [NBP3-16555] - Analysis of extracts of various cell lines, using PAR2 Rabbit mAb (NBP3-16555) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Western Blot: PAR2 Antibody (9X8E6) [NBP3-16555] - Analysis of extracts of Rat large intestine, using PAR2 Rabbit mAb (NBP3-16555) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

Immunohistochemistry: PAR2 Antibody (9X8E6) [NBP3-16555] - Immunohistochemistry analysis of paraffin-embedded Human gastric cancer tissue using PAR2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PAR2 Antibody (9X8E6) [NBP3-16555] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using PAR2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PAR2 Antibody (9X8E6) [NBP3-16555] - Immunohistochemistry analysis of paraffin-embedded Human breast tissue using PAR2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PAR2 Antibody (9X8E6) [NBP3-16555] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using PAR2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PAR2 Antibody (9X8E6) [PAR2] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using PAR2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PAR2 Antibody (9X8E6) [PAR2] - Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using PAR2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: PAR2 Antibody (9X8E6) [PAR2] - Immunohistochemistry analysis of paraffin-embedded Human pancreatic cancer tissue using PAR2 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 9X8E6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PAR2 Antibody (9X8E6) Summary

• Description: Novus Biologicals Rabbit PAR2 Antibody (9X8E6) (NBP3-16555) is a recombinant monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 298-397 of human PAR2 (P55085). ICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: F2RL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunohistochemistry 1:500 - 1:2000
  • Immunohistochemistry-Paraffin 1:500 - 1:2000
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PAR2 Antibody (9X8E6)

• CFIIRL1
• coagulation factor II (thrombin) receptor-like 1
• Coagulation factor II receptor-like 1
• F2RL1
• GPCR11
• GPR11protease-activated receptor 2
• G-protein coupled receptor 11
• PAR2
• PAR-2
• PAR2G protein-coupled receptor-11
• proteinase-activated receptor 2
• proteinase-activated receptor-2
• Thrombin receptor-like 1

Background

The Proteinase-activated receptor 2 (PAR2) is a member of the proteinase-activated receptor subfamily. It is activated through proteolytic exposure of an occult tethered ligand by trypsin and trypsin-like proteases. This is in contrast to other members of the subfamily which are activated by the protease thrombin. PAR2 has been implicated in acute inflammatory response, asthma, and pain transmission. PAR2 expression has been documented in the periphery. ESTs have been isolated from adrenal, brain, breast, heart/melanocyte/uterus, kidney, lung, and vessel libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: F2RL1