PAR2 Antibody (9X8E6) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 298-397 of human PAR2 (P55085). ICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
F2RL1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Immunohistochemistry 1:500 - 1:2000
- Immunohistochemistry-Paraffin 1:500 - 1:2000
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
44 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PAR2 Antibody (9X8E6)
Background
The Proteinase-activated receptor 2 (PAR2) is a member of the proteinase-activated receptor subfamily. It is activated through proteolytic exposure of an occult tethered ligand by trypsin and trypsin-like proteases. This is in contrast to other members of the subfamily which are activated by the protease thrombin. PAR2 has been implicated in acute inflammatory response, asthma, and pain transmission. PAR2 expression has been documented in the periphery. ESTs have been isolated from adrenal, brain, breast, heart/melanocyte/uterus, kidney, lung, and vessel libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, IHC-P, WB (-)
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IHC, IP, WB
Publications for PAR2 Antibody (NBP3-16555) (0)
There are no publications for PAR2 Antibody (NBP3-16555).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PAR2 Antibody (NBP3-16555) (0)
There are no reviews for PAR2 Antibody (NBP3-16555).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PAR2 Antibody (NBP3-16555) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PAR2 Products
Research Areas for PAR2 Antibody (NBP3-16555)
Find related products by research area.
|
Blogs on PAR2