JTB Antibody


Western Blot: JTB Antibody [NBP1-81746] - Analysis in control (vector only transfected HEK293T lysate) and JTB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: JTB Antibody [NBP1-81746] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: JTB Antibody [NBP1-81746] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

JTB Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL
Specificity of human JTB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
JTB Protein (NBP1-81746PEP)
Read Publication using NBP1-81746.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for JTB Antibody

  • Gm622
  • hJT
  • HJTB
  • HSPC222
  • JTB
  • Jumping translocation breakpoint protein
  • jumping translocation breakpoint
  • PAR Protein
  • PAR
  • Prostate androgen-regulated protein
  • protein JTB


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
Species: Hu
Applications: WB, IP, DirELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for JTB Antibody (NBP1-81746)(1)

Reviews for JTB Antibody (NBP1-81746) (0)

There are no reviews for JTB Antibody (NBP1-81746). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for JTB Antibody (NBP1-81746) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional JTB Products

Bioinformatics Tool for JTB Antibody (NBP1-81746)

Discover related pathways, diseases and genes to JTB Antibody (NBP1-81746). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JTB Antibody (NBP1-81746)

Discover more about diseases related to JTB Antibody (NBP1-81746).

Pathways for JTB Antibody (NBP1-81746)

View related products by pathway.

PTMs for JTB Antibody (NBP1-81746)

Learn more about PTMs related to JTB Antibody (NBP1-81746).

Research Areas for JTB Antibody (NBP1-81746)

Find related products by research area.

Blogs on JTB

There are no specific blogs for JTB, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our JTB Antibody and receive a gift card or discount.


Gene Symbol JTB