TRF-1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLSKLQHGTQQQDLNKKERRVGTLQSTKKKKESRRATESRIPVSKSQPVTPE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TERF1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TRF-1 Antibody - BSA Free
Background
Telomeric repeat binding factor 1 (TRF1, TERF1, PIN2, TRBF1) and telomeric repeat binding factor 2 (TRF2, TERF2, TRBF2) are present at telomeres throughout the cell cycle, where they regulate telomerase by acting in cis to limit the elongation of individual chromosome ends. Telomerase adds hexameric repeats of TTAGGG to the ends of chromosomal DNA. This telomerase enzyme plays an influential role in cellular immortalization and cellular senescence. TRF1 negatively regulates telomere elongation, while TRF2 protects the chromosome ends by inhibiting end-to-end fusions. Downregulation of TRF expression in tumor cells may contribute to cell immortalization and malignant progression. TRF1 has an acidic N-terminus while TRF2 has a basic N-terminus. TRF2 localizes in the nucleolus at G0 and S and diffuses out of the nucleolus in G2 phase. During mitosis TRF2 disperses from the condensed chromosomes and returns to the nucleolus at cytokinesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC, IHC, IP, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Publications for TRF-1 Antibody (NBP2-57285) (0)
There are no publications for TRF-1 Antibody (NBP2-57285).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRF-1 Antibody (NBP2-57285) (0)
There are no reviews for TRF-1 Antibody (NBP2-57285).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TRF-1 Antibody (NBP2-57285) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TRF-1 Products
Research Areas for TRF-1 Antibody (NBP2-57285)
Find related products by research area.
|
Blogs on TRF-1