![Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Analysis in human cervix, uterine and skeletal muscle tissues. Corresponding TRH RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Thyrotropin-Releasing-Hormone-Antibody-Immunohistochemistry-Paraffin-NBP2-34014-img0001.jpg "Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Analysis in human cervix, uterine and skeletal muscle tissues. Corresponding TRH RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Thyrotropin Releasing Hormone Antibody - BSA Free (NBP2-34014) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HKRQHPGRREDEASWSVDVTQHKRQHPGRRSPWLAYAVPKRQHPGRRLADPKAQRSWEE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TRH |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Thyrotropin Releasing Hormone Antibody (NBP2-34014)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Thyrotropin-Releasing-Hormone-Antibody-Immunohistochemistry-Paraffin-NBP2-34014-img0005.jpg "Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Thyrotropin-Releasing-Hormone-Antibody-Immunohistochemistry-Paraffin-NBP2-34014-img0002.jpg "Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human endometrium shows weak to moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Thyrotropin-Releasing-Hormone-Antibody-Immunohistochemistry-Paraffin-NBP2-34014-img0003.jpg "Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human endometrium shows weak to moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/Thyrotropin-Releasing-Hormone-Antibody-Immunohistochemistry-Paraffin-NBP2-34014-img0004.jpg "Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.")
![Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] -Staining of human cerebral cortex shows weak cytoplasmic-membranous positivity in endothelial cells.](http://images.novusbio.com/fullsize/antibody/nbp2-34014_rabbit-polyclonal-thyrotropin-releasing-hormone-antibody-immunohistochemistry-paraffin-295202481959..jpg "Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] -Staining of human cerebral cortex shows weak cytoplasmic-membranous positivity in endothelial cells.")
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")