TREM2 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: TREM2 Antibody [NBP3-35146] - Immunofluorescence analysis of PC-12 cells using TREM2 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat ...read more
Western Blot: TREM2 Antibody [NBP3-35146] - Western Blot analysis of lysates from Rat lung using TREM2 Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

TREM2 Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 19-161 of human TREM2 (NP_061838.1).

Sequence:
HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TREM2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:1000 - 1:5000
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TREM2 Antibody - BSA Free

  • PLOSL2
  • TREM2
  • TREM-2
  • Trem2a
  • Trem2b
  • Trem2c
  • TREM-2triggering receptor expressed on myeloid cells 2a
  • Triggering receptor expressed on monocytes 2
  • triggering receptor expressed on myeloid cells 2

Background

Triggering receptor expressed on myeloid cells-2 (TREM2) is a cell surface transmembrane glycoprotein receptor belonging to the immunoglobulin (Ig) subfamily that functions in pathology-induced immune system signaling (1). The TREM2 protein is encoded by the TREM2 gene located on chromosome 6p21.1 in humans and chromosome 17 in mouse (2). TREM2 is synthesized as a protein of 230 amino acids (aa) in length with a theoretic molecular weight (MW) of 25.4 kDa. TREM2 is comprised of a signaling peptide, an extracellular V-type Ig domain, a stalk region, a transmembrane helical domain, and a cytosolic tail (1-4). The receptor is expressed on cells of myeloid lineage including dendritic cells (DCs) and tissue-specific macrophages (e.g. microglia, osteoclasts) (2,3). There are several reported ligands for TREM2 such as bacterial components, lipoproteins, and apolipoproteins (1-3,5). Upon TREM2 receptor-ligand binding, the TREM2 protein interacts with adaptor proteins DNAX activation protein 12 (DAP12) and DAP10 (1-3,5). The TREM2-DAP12 complex leads to phosphorylation of DAP12's immunoreceptor tyrosine-based activation (ITAM) motif, followed by recruitment of Syk kinase, and activation of downstream signaling molecules such as phosphatidylinositol 3-kinase (PI3K), extracellular signal-regulated protein kinase (ERK), and phospholipase Cgamma (PLCgamma) (3,5). A soluble form of TREM2 (sTREM2) is generated by ectodomain shedding via a disintegrin and metalloproteinase 10 (ADAM10) and ADAM17, promoting survival and inflammation through the PI3K and nuclear factor kappa B (NFkappaB) pathways (2,5). TREM2 has been linked to myeloid maturation, proliferation, survival, phagocytosis, response to neurodegenerative cues, and regulation of inflammation (2,3).

TREM2 is upregulated under many pathological conditions and has been of particular interest in neurodegenerative disorders like Alzheimer's disease (AD) where it helps activate microglial responses (1-3,5). Studies have found that sTREM2 is typically elevated in the cerebral spinal fluid (CSF) of AD patients compared to healthy counterparts and may serve as a biomarker of AD (2). While TREM2-mediated microglial activation is considered beneficial in some disease contexts (e.g. demyelinating diseases, ischemia), it is detrimental in others (e.g. peripheral nerve injury) and may be dependent on disease stage, as observed in AD (2,5). Microglia promote amyloid-beta (Abeta) clearance, phagocytosis and reduce tau proliferation in the early stages of AD but can increase Abeta accumulation and tau propagation in late stages of AD (2). Recent studies have also suggested a role for TREM2 in cancer, where it supports an immune-suppressive tumor microenvironment such as reduced of T cell proliferation (1,6). Therapeutic targeting of the TREM2 pathway can be directed towards ligand binding to downstream signaling (1). Potential therapeutic strategies include using monoclonal antibodies or small molecules to either enhance or block signaling (1,6). While more work needs to be done, initial studies targeting TREM2 for cancer immunotherapy is promising (6).

References

1. Deczkowska A, Weiner A, Amit I. The Physiology, Pathology, and Potential Therapeutic Applications of the TREM2 Signaling Pathway. Cell. 2020; 181(6):1207-1217. https://doi.org/10.1016/j.cell.2020.05.003

2. Qin Q, Teng Z, Liu C, Li Q, Yin Y, Tang Y. TREM2, microglia, and Alzheimer's disease. Mech Ageing Dev. 2021; 195:111438. https://doi.org/10.1016/j.mad.2021.111438

3. Kober DL, Brett TJ. TREM2-Ligand Interactions in Health and Disease. J Mol Biol. 2017; 429(11):1607-1629. https://doi.org/10.1016/j.jmb.2017.04.004

4. Uniprot (Q9NZC2)

5. Konishi H, Kiyama H. Microglial TREM2/DAP12 Signaling: A Double-Edged Sword in Neural Diseases. Front Cell Neurosci. 2018; 12:206. https://doi.org/10.3389/fncel.2018.00206

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85313
Species: Hu
Applications: IHC,  IHC-P
MAB1278
Species: Hu
Applications: AgAct, CyTOF-ready, Flow
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC,  IHC-P, WB
462-TEC
Species: Mu
Applications: BA
DY417
Species: Mu
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
485-MI
Species: Mu
Applications: BA
NB100-56732
Species: Hu, Mu
Applications: CUT&Tag, ICC/IF, IHC, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB2274
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
6507-IL/CF
Species: Hu
Applications: BA
MAB1633
Species: Mu
Applications: WB
MAB2384
Species: Hu
Applications: CyTOF-ready, Flow, WB
DCP00
Species: Hu
Applications: ELISA
NBP1-84234
Species: Hu
Applications: IHC,  IHC-P, WB
MAB197
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
NB100-1028
Species: Ca, Eq, Fe, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, PEP-ELISA, WB

Publications for TREM2 Antibody (NBP3-35146) (0)

There are no publications for TREM2 Antibody (NBP3-35146).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TREM2 Antibody (NBP3-35146) (0)

There are no reviews for TREM2 Antibody (NBP3-35146). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TREM2 Antibody (NBP3-35146) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TREM2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol TREM2