TREML1/TLT-1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: TREML1/TLT-1 Antibody [NBP1-84234] - Staining in human bone marrow and colon tissues using anti-TREML1 antibody. Corresponding TREML1 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: TREML1/TLT-1 Antibody [NBP1-84234] - Staining of human bone marrow, colon, kidney and testis using Anti-TREML1 antibody NBP1-84234 (A) shows similar protein ...read more
Western Blot: TREML1/TLT-1 Antibody [NBP1-84234] - Analysis in control (vector only transfected HEK293T lysate) and TREML1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: TREML1/TLT-1 Antibody [NBP1-84234] - Staining of human testis.
Immunohistochemistry-Paraffin: TREML1/TLT-1 Antibody [NBP1-84234] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: TREML1/TLT-1 Antibody [NBP1-84234] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: TREML1/TLT-1 Antibody [NBP1-84234] - Staining of human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TREML1/TLT-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: APVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TREML1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TREML1/TLT-1 Recombinant Protein Antigen (NBP1-84234PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TREML1/TLT-1 Antibody

  • dJ238O23.3
  • GLTL1825
  • PRO3438
  • TLT1
  • TLT-1
  • TLT1MGC119173
  • TREML1
  • trem-like transcript 1 protein
  • triggering receptor expressed on myeloid cells-like 1
  • Triggering receptor expressed on myeloid cells-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DTRM10C
Species: Hu
Applications: ELISA
AF1729
Species: Mu
Applications: ELISA, ICC, KO, WB
137-PS
Species: Hu
Applications: BA
2249-NK
Species: Hu
Applications: BA
AF1213
Species: Mu
Applications: Block, ICC, IHC, WB
NBP2-67321
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
MAB5240
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB400-144
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF6354
Species: Mu
Applications: CyTOF-ready, Flow, WB
NBP2-67584
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-81858
Species: Hu
Applications: IHC, IHC-P, WB
MAB6758
Species: Mu
Applications: CyTOF-ready, Flow, ICC
AF2788
Species: Mu
Applications: CyTOF-ready, Flow, WB
NBP2-59376
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF2800
Species: Mu
Applications: Block, IHC, WB
NBP1-84234
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TREML1/TLT-1 Antibody (NBP1-84234) (0)

There are no publications for TREML1/TLT-1 Antibody (NBP1-84234).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TREML1/TLT-1 Antibody (NBP1-84234) (0)

There are no reviews for TREML1/TLT-1 Antibody (NBP1-84234). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TREML1/TLT-1 Antibody (NBP1-84234) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TREML1/TLT-1 Products

Bioinformatics Tool for TREML1/TLT-1 Antibody (NBP1-84234)

Discover related pathways, diseases and genes to TREML1/TLT-1 Antibody (NBP1-84234). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TREML1/TLT-1 Antibody (NBP1-84234)

Discover more about diseases related to TREML1/TLT-1 Antibody (NBP1-84234).
 

Pathways for TREML1/TLT-1 Antibody (NBP1-84234)

View related products by pathway.

PTMs for TREML1/TLT-1 Antibody (NBP1-84234)

Learn more about PTMs related to TREML1/TLT-1 Antibody (NBP1-84234).

Blogs on TREML1/TLT-1

There are no specific blogs for TREML1/TLT-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TREML1/TLT-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TREML1