DAP12 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Analysis in human bone marrow and skeletal muscle tissues using NBP1-85313 antibody. Corresponding TYROBP RNA-seq data are ...read more
Western Blot: DAP12 Antibody [NBP1-85313] - Analysis in control (vector only transfected HEK293T lysate) and TYROBP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Staining of human small intestine shows strong cytoplasmic positivity in goblet cells.
Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Staining of human bone marrrow shows moderate cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

DAP12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TYROBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DAP12 Protein (NBP1-85313PEP)
Publications
Read Publication using NBP1-85313.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DAP12 Antibody

  • DAP12
  • DAP12PLOSL
  • DNAX-activation protein 12
  • KARAP
  • KARAPPLO-SL
  • KAR-associated protein
  • killer activating receptor associated protein
  • Killer-activating receptor-associated protein
  • TYRO protein tyrosine kinase binding protein
  • TYRO protein tyrosine kinase-binding protein
  • TYROBP

Background

DAP12 is a transmembrane adaptor protein that is non-covalently associated with several cell surface receptors on natural killer (NK), myeloid, and presumably neuronal cells. DAP12 contains an ITAM domain that preferentially recruits the protein tyrosine kinase Syk to initiate signal transduction. Deficiency of DAP12 results in reduced antigen presentation function by myeloid cells and defects in function of certain NK cell receptors in mice, as well as presenile dementia and bone cysts in humans.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DAP12 Antibody (NBP1-85313)(1)

Reviews for DAP12 Antibody (NBP1-85313) (0)

There are no reviews for DAP12 Antibody (NBP1-85313). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAP12 Antibody (NBP1-85313) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DAP12 Products

Research Areas for DAP12 Antibody (NBP1-85313)

Find related products by research area.

Blogs on DAP12.

Harnessing Natural Killer Cell Activity for Anti-Tumor Immunotherapy
By Victoria Osinski, PhDWhat’s “Natural” About Natural Killer (NK) Cells?For immunologists, the term cytotoxicity often conjures up images of an army of antigen specific CD8+ T cells deploying to ...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DAP12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TYROBP