DAP12 Antibody


Western Blot: DAP12 Antibody [NBP1-85313] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

DAP12 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:FLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DAP12 Protein (NBP1-85313PEP)
Read Publication using NBP1-85313.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DAP12 Antibody

  • DAP12
  • DNAX-activation protein 12
  • KAR-associated protein
  • killer activating receptor associated protein
  • Killer-activating receptor-associated protein
  • TYRO protein tyrosine kinase binding protein
  • TYRO protein tyrosine kinase-binding protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, PEP-ELISA
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, ICC/IF
Species: Mu
Applications: WB, Flow, AgAct, CyTOF-ready, ICC
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ELISA, PLA
Species: Hu
Applications: Flow, Block, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
Species: Hu
Applications: Flow, CyTOF-ready

Publications for DAP12 Antibody (NBP1-85313)(1)

Reviews for DAP12 Antibody (NBP1-85313) (0)

There are no reviews for DAP12 Antibody (NBP1-85313). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAP12 Antibody (NBP1-85313) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DAP12 Products

Bioinformatics Tool for DAP12 Antibody (NBP1-85313)

Discover related pathways, diseases and genes to DAP12 Antibody (NBP1-85313). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAP12 Antibody (NBP1-85313)

Discover more about diseases related to DAP12 Antibody (NBP1-85313).

Pathways for DAP12 Antibody (NBP1-85313)

View related products by pathway.

PTMs for DAP12 Antibody (NBP1-85313)

Learn more about PTMs related to DAP12 Antibody (NBP1-85313).

Research Areas for DAP12 Antibody (NBP1-85313)

Find related products by research area.

Blogs on DAP12

There are no specific blogs for DAP12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DAP12 Antibody and receive a gift card or discount.


Gene Symbol TYROBP