DAP12 Antibody

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Analysis in human bone marrow and skeletal muscle tissues using NBP1-85313 antibody. Corresponding TYROBP RNA-seq data are presented for the same tissues.

Western Blot: DAP12 Antibody [NBP1-85313] - Analysis in control (vector only transfected HEK293T lysate) and TYROBP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Staining of human small intestine shows strong cytoplasmic positivity in goblet cells.

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Staining of human bone marrrow shows moderate cytoplasmic positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: DAP12 Antibody [NBP1-85313] - Staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DAP12 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TYROBP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DAP12 Protein (NBP1-85313PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DAP12 Antibody

• DAP12
• DAP12PLOSL
• DNAX-activation protein 12
• KARAP
• KARAPPLO-SL
• KAR-associated protein
• killer activating receptor associated protein
• Killer-activating receptor-associated protein
• TYRO protein tyrosine kinase binding protein
• TYRO protein tyrosine kinase-binding protein
• TYROBP

Background

DAP12 is a transmembrane adaptor protein that is non-covalently associated with several cell surface receptors on natural killer (NK), myeloid, and presumably neuronal cells. DAP12 contains an ITAM domain that preferentially recruits the protein tyrosine kinase Syk to initiate signal transduction. Deficiency of DAP12 results in reduced antigen presentation function by myeloid cells and defects in function of certain NK cell receptors in mice, as well as presenile dementia and bone cysts in humans.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DAP12 Antibody (NBP1-85313)(1)

Publication using NBP1-85313

• Preusse C, Goebel HH, Pehl D et al. Th2-M2 immunity in lesions of muscular sarcoidosis and macrophagic myofasciitis. Neuropathol Appl Neurobiol 2015-02-25 [PMID: 25711697]

Bioinformatics

• Gene Symbol: TYROBP