Tissue alpha-L-Fucosidase/FUCA1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: VQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FUCA1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Tissue alpha-L-Fucosidase/FUCA1 Antibody - BSA Free
Background
Alpha-L-fucosidase (EC 3.2.1.51) is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids (Occhiodoro et al., 1989 [PubMed 2803312]). At least 2 separate polymorphic alpha-L-fucosidases are recognized in man: that in tissues, FUCA1, which is deficient in fucosidosis (MIM 230000), and that in plasma, FUCA2 (MIM 136820).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Hu
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Dr, Fi, Gt, Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC
Publications for Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044) (0)
There are no publications for Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044) (0)
There are no reviews for Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Tissue alpha-L-Fucosidase/FUCA1 Products
Research Areas for Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044)
Find related products by research area.
|
Blogs on Tissue alpha-L-Fucosidase/FUCA1