RPL10 Antibody

Images

 
Western Blot: RPL10 Antibody [NBP1-84037] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Western Blot: RPL10 Antibody [NBP1-84037] - Analysis in human cell line HeLa.
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: RPL10 Antibody [NBP1-84037] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPL10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KMSSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPSRGPLDKWW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RPL10 Protein (NBP1-84037PEP)
Publications
Read Publication using NBP1-84037.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPL10 Antibody

  • 60S ribosomal protein L10
  • DXS648EFLJ27072
  • DXS648FLJ23544
  • Laminin receptor homolog
  • NOV
  • Protein QM
  • QMDKFZp686J1851
  • ribosomal protein L10
  • Tumor suppressor QM
  • Wilms tumor-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-41266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-20211
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00028299-P01
Species: Hu
H00026156-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-356
Species: Hu, Rb
Applications: WB, Simple Western, B/N, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-07996
Species: Hu
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for RPL10 Antibody (NBP1-84037)(1)

Reviews for RPL10 Antibody (NBP1-84037) (0)

There are no reviews for RPL10 Antibody (NBP1-84037). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPL10 Antibody (NBP1-84037) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPL10 Products

Bioinformatics Tool for RPL10 Antibody (NBP1-84037)

Discover related pathways, diseases and genes to RPL10 Antibody (NBP1-84037). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPL10 Antibody (NBP1-84037)

Discover more about diseases related to RPL10 Antibody (NBP1-84037).
 

Pathways for RPL10 Antibody (NBP1-84037)

View related products by pathway.

PTMs for RPL10 Antibody (NBP1-84037)

Learn more about PTMs related to RPL10 Antibody (NBP1-84037).

Blogs on RPL10

There are no specific blogs for RPL10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPL10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL10