Home » RHD » RHD Antibodies » RHD Antibody

RHD Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml
Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml
Western Blot: RHD Antibody [NBP2-84247] - WB Suggested Anti-RHD Antibody. Titration: 1.0 ug/ml. Positive Control: RPMI-8226 Whole Cell.RHD is strongly supported by BioGPS gene expression data to be expressed in RPMI 8226
Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: 293T. Antibody Dilution: 1.0ug/mlRHD is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells
Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml
Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

RHD Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of RHD. Peptide sequence: DYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAMLGA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RHD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RHD Antibody

  • blood group Rh(D) polypeptide
  • CD240D
  • DIIIc
  • Rh blood group, D antigen
  • RH
  • RH30
  • Rh4
  • RHCED
  • RhDCw
  • RHDel
  • RHDVA(TT)
  • RhII
  • RhK562-II
  • RhPI
  • RHPII
  • RHXIII

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RHCE Antibody
(BRIC69)
NB100-65887
RHCE Antibody (BRIC69)
(1 Publication)
Species: Hu
Applications: Flow, IP
Lewis A Blood
Group Antigen Antibod ...
NB500-525
Immunohistochemistry: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - Staining of human colon adenocarcinoma (paraffin-embedded sections) with anti-Blood Group Lewis a (7LE).
Immunohistochemistry-Paraffin: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - Staining of colorectal adenocarcinoma with anti-FUT3/Blood Group Lewis A (7LE).
Immunohistochemistry-Paraffin: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - Staining of human pancreas (paraffin-embedded sections) with anti-Blood Group Lewis a (7LE).
(2 Publications)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Recombinant Human
RHAG GST (N-Term) Pro ...
H00006005-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Rhodopsin Antibody
(B630)
NBP2-25160
Western Blot: Rhodopsin Antibody (B630) [NBP2-25160] - Blot of bovine retinal extracts. The antibody stains a band corresponing to retinal Rhodopsin at about 35kDa. Bands about 70 kDa and 140 kDa are aggregated forms of Rhodopsin. Note, due to the highly hydrophobic nature of Rhodopsin, it is important to avoid boiling samples containing this protein in SDS-PAGE sample buffer, as this will result in even more extensive aggregation of the Rhodopsin protein and appearance of more of this high molecular weight material.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (B630) [NBP2-25160] - High magnification confocal image of pig retinal section stained with NBP2-25160 (Green). Rhodopsin is most abundant in the rod outer segments (ROS) of retina, clearly localized in rod membranes. The rod inner segments (RIS) and rod nuclei in the outer nuclear layer (ONL) are also seen in this image. Nuclear DNA was stained with DAPI (blue).
(2 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
Complement C4b/d
Antibody (16D2)
NB200-541
Western Blot: Complement C4b/d Antibody (16D2) [NB200-541] - Western blot analysis of C4 expression in J774.A1 (A) aand mouse PBL (B) whole cell lysates.
(6 Publications)
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Glycophorin A
Antibody (R10) [Uncon ...
MAB1228
Glycophorin A was detected in immersion fixed paraffin-embedded sections of human lung using Mouse Anti-Human Glycophorin A Monoclonal Antibody (Catalog # MAB1228) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes of red blood cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
TF‑1 human erythroleukemic cell line was stained with Mouse Anti-Human Glycophorin A Monoclonal Antibody (Catalog # MAB1228, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B).
(2 Publications)
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
CD55/DAF Antibody
NBP1-85466
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining in human lung and kidney tissues using anti-CD55 antibody. Corresponding CD55 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: CD55/DAF Antibody [NBP1-85466] - Staining of human lung shows high expression.
(2 Publications)
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
DARC Antibody
[Unconjugated]
AF6695
Western blot shows lysates of mouse liver tissue and rat liver tissue. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Mouse/Rat DARC Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6695) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for DARC at approximately 40 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
DARC was detected in perfusion fixed frozen sections of mouse skin using Sheep Anti-Mouse/Rat DARC Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6695) at 0.5 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to the hair follicle. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Mouse splenocytes were stained with Rat Anti-Mouse TER‑119 APC‑conjugated Monoclonal Antibody (Catalog # FAB1125A) and either (A) Sheep Anti-Mouse/Rat DARC Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6695) or (B) Normal Sheep IgG Control (Catalog # 5-001-A) followed by Allophycocyanin-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # F0127).
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(1 Publication)
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(22 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
FUZ Antibody
NBP2-24750
Western Blot: FUZ Antibody [NBP2-24750] - analysis of FUZ in human lung lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse lung and 4) rat lung using this antibody. 0 ug/ml, 2.0 ug/ml and 6.0 ug/ml respectively.
Immunohistochemistry-Paraffin: FUZ Antibody [NBP2-24750] - Formalin-fixed, paraffin-embedded human lung stained with FUZ antibody at 15 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
RhoD Antibody
NBP1-58359
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Liver Tissue Observed Staining: Cytoplasm in sinusoids of liver Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Expos
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
Complement Factor
B Antibody
NBP1-89985
Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: Complement Factor B Antibody [NBP1-89985] - Staining of human cell line ASC TERT1 shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(35 Reviews)
(649 Publications)
Species: Hu
CD47 Antibody
(B6H12.2) - Azide Fre
NBP2-31106
Western Blot: CD47 Antibody (B6H12.2) - Azide Free [NBP2-31106] - Detection of CD47 expression on two hematological cancer cell lines, Jurkat and Raji. WB image submitted by a verified customer review.
Immunocytochemistry: CD47 Antibody (B6H12.2) - Azide Free [NBP2-31106] - Human trabecular meshwork (primary ocular cells). Image from verified customer review.
Immunohistochemistry-Paraffin: CD47 Antibody (B6H12.2) - Azide Free [NBP2-31106] - Tissue section of human normal breast using mouse monoclonal CD47 antibody (clone B6H12.2) at 0.5ug/ml concentration. The ductal/acinar epithelial cells in the breast section developed specific membrane-cytoplasmic staining.
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS, ICC
Calretinin Antibody
NBP1-88220
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining in human testis and skeletal muscle tissues using NBP1-88220 antibody. Corresponding CALB2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human cerebellum, skeletal muscle, stomach and testis using Anti-CALB2 antibody NBP1-88220 (A) shows similar protein distribution across tissues to independent antibody NBP1-88221 (B).
Western Blot: Calretinin Antibody [NBP1-88220] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
RHD Antibody
NBP2-84247
RHD Antibody
Species: Hu
Applications: WB

Publications for RHD Antibody (NBP2-84247) (0)

There are no publications for RHD Antibody (NBP2-84247).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHD Antibody (NBP2-84247) (0)

There are no reviews for RHD Antibody (NBP2-84247). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RHD Antibody (NBP2-84247) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional RHD Products

Array NBP2-84247

Bioinformatics Tool for RHD Antibody (NBP2-84247)

Discover related pathways, diseases and genes to RHD Antibody (NBP2-84247). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHD Antibody (NBP2-84247)

Discover more about diseases related to RHD Antibody (NBP2-84247).
 

Pathways for RHD Antibody (NBP2-84247)

View related products by pathway.

PTMs for RHD Antibody (NBP2-84247)

Learn more about PTMs related to RHD Antibody (NBP2-84247).

Blogs on RHD

There are no specific blogs for RHD, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHD Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RHD