RHD Antibody


Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml
Western Blot: RHD Antibody [NBP2-84247] - WB Suggested Anti-RHD Antibody. Titration: 1.0 ug/ml. Positive Control: RPMI-8226 Whole Cell.RHD is strongly supported by BioGPS gene expression data to be expressed in RPMI 8226
Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: 293T. Antibody Dilution: 1.0ug/mlRHD is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells
Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml
Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

RHD Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of RHD. Peptide sequence: DYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAMLGA The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for RHD Antibody

  • blood group Rh(D) polypeptide
  • CD240D
  • DIIIc
  • Rh blood group, D antigen
  • RH
  • RH30
  • Rh4
  • RhDCw
  • RHDel
  • RhII
  • RhK562-II
  • RhPI


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, IHC
Species: Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow-CS, Flow, ICC, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB

Publications for RHD Antibody (NBP2-84247) (0)

There are no publications for RHD Antibody (NBP2-84247).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHD Antibody (NBP2-84247) (0)

There are no reviews for RHD Antibody (NBP2-84247). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RHD Antibody (NBP2-84247) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RHD Products

Array NBP2-84247

Bioinformatics Tool for RHD Antibody (NBP2-84247)

Discover related pathways, diseases and genes to RHD Antibody (NBP2-84247). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RHD Antibody (NBP2-84247)

Discover more about diseases related to RHD Antibody (NBP2-84247).

Pathways for RHD Antibody (NBP2-84247)

View related products by pathway.

PTMs for RHD Antibody (NBP2-84247)

Learn more about PTMs related to RHD Antibody (NBP2-84247).

Research Areas for RHD Antibody (NBP2-84247)

Find related products by research area.

Blogs on RHD

There are no specific blogs for RHD, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RHD Antibody and receive a gift card or discount.


Gene Symbol RHD