RHD Antibody

Images

 
Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml
Western Blot: RHD Antibody [NBP2-84247] - WB Suggested Anti-RHD Antibody. Titration: 1.0 ug/ml. Positive Control: RPMI-8226 Whole Cell.RHD is strongly supported by BioGPS gene expression data to be expressed in RPMI 8226
Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: 293T. Antibody Dilution: 1.0ug/mlRHD is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells
Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml
Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

RHD Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of RHD. Peptide sequence: DYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAMLGA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RHD
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for RHD Antibody

  • blood group Rh(D) polypeptide
  • CD240D
  • DIIIc
  • Rh blood group, D antigen
  • RH
  • RH30
  • Rh4
  • RHCED
  • RhDCw
  • RHDel
  • RHDVA(TT)
  • RhII
  • RhK562-II
  • RhPI
  • RHPII
  • RHXIII

Background

The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The classification of Rh positive and Rh negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. Alternative splicing of the gene results in four transcript variants encoding four different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RHD Antibody (NBP2-84247) (0)

There are no publications for RHD Antibody (NBP2-84247).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHD Antibody (NBP2-84247) (0)

There are no reviews for RHD Antibody (NBP2-84247). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RHD Antibody (NBP2-84247) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHD Products

Array NBP2-84247

Research Areas for RHD Antibody (NBP2-84247)

Find related products by research area.

Blogs on RHD

There are no specific blogs for RHD, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHD