![Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/RHD-Antibody-Western-Blot-NBP2-84247-img0004.jpg "Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of RHD. Peptide sequence: DYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKDQTATIPSLSAMLGA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RHD |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry-Paraffin: RHCE Antibody [NBP3-17923] - Staining of human bone marrow shows strong positivity in hematopoietic cells.](http://images.novusbio.com/images2/RHCE-Antibody-Immunohistochemistry-Paraffin-NBP3-17923-img0001.jpg)
![Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.](http://images.novusbio.com/images2/HLA-DQ-DR-DP-Antibody-(HLA-Pan-2967R)---Azide-and-BSA-Free-Protein-Array-NBP2-79843-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).](http://images.novusbio.com/images2/HLA-DQ-DR-DP-Antibody-(HLA-Pan-2967R)---Azide-and-BSA-Free-Immunocytochemistry-Immunofluorescence-NBP2-79843-img0002.jpg)
![Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).](http://images.novusbio.com/images2/HLA-DQ-DR-DP-Antibody-(HLA-Pan-2967R)---Azide-and-BSA-Free-Western-Blot-NBP2-79843-img0003.jpg)
![Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Flow-Cytometry-NB100-524-img0014.jpg)
![Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Flow-Cytometry-NB100-524-img0015.jpg)
![Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Immunohistochemistry-Frozen-NB100-524-img0016.jpg)
![Western Blot: FUZ Antibody [NBP2-24750] - analysis of FUZ in human lung lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse lung and 4) rat lung using this antibody. 0 ug/ml, 2.0 ug/ml and 6.0 ug/ml respectively.](http://images.novusbio.com/images2/FUZ-Antibody-Western-Blot-NBP2-24750-img0001.jpg)
![Immunohistochemistry-Paraffin: FUZ Antibody [NBP2-24750] - Formalin-fixed, paraffin-embedded human lung stained with FUZ antibody at 15 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.](http://images.novusbio.com/images2/FUZ-Antibody-Immunohistochemistry-Paraffin-NBP2-24750-img0003.jpg)
![Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.](http://images.novusbio.com/images2/RhoD-Antibody-Immunohistochemistry-Paraffin-NBP1-58359-img0003.jpg)
![Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml](http://images.novusbio.com/images2/RhoD-Antibody-Western-Blot-NBP1-58359-img0002.jpg)
![Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X.](http://images.novusbio.com/images2/RhoD-Antibody-Immunohistochemistry-NBP1-58359-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: Complement Factor B Antibody [NBP1-89985] - Staining of human cell line ASC TERT1 shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/images2/Complement-Factor-B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89985-img0010.jpg)
![Western Blot: Complement Factor B Antibody [NBP1-89985] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/images2/Complement-Factor-B-Antibody-Western-Blot-NBP1-89985-img0009.jpg)
![Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human placenta shows strong positivity in trophoblastic cells.](http://images.novusbio.com/images2/Complement-Factor-B-Antibody-Immunohistochemistry-Paraffin-NBP1-89985-img0011.jpg)
![Immunocytochemistry: CD47 Antibody (B6H12.2) - Azide Free [NBP2-31106] - Human trabecular meshwork (primary ocular cells). Image from verified customer review.](http://images.novusbio.com/images2/CD47-Antibody-(B6H12.2)---Azide-Free-Immunocytochemistry-NBP2-31106-img0007.jpg)
![Western Blot: CD47 Antibody (B6H12.2) - Azide Free [NBP2-31106] - Detection of CD47 expression on two hematological cancer cell lines, Jurkat and Raji. WB image submitted by a verified customer review.](http://images.novusbio.com/images2/CD47-Antibody-(B6H12.2)---Azide-Free-Western-Blot-NBP2-31106-img0008.jpg)
![Flow Cytometry: CD47 Antibody (B6H12.2) - Azide Free [NBP2-31106] - A surface stain was performed on A431 cells with CD47 Antibody [B6H12.2] NBP2-31106PCP (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to PerCP.](http://images.novusbio.com/images2/CD47-Antibody-(B6H12.2)---Azide-Free-Flow-Cytometry-NBP2-31106-img0009.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for RHD Antibody (NBP2-84247)Discover more about diseases related to RHD Antibody (NBP2-84247).
| Pathways for RHD Antibody (NBP2-84247)View related products by pathway.
|
PTMs for RHD Antibody (NBP2-84247)Learn more about PTMs related to RHD Antibody (NBP2-84247).
| Research Areas for RHD Antibody (NBP2-84247)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RHD |
![Western Blot: RHD Antibody [NBP2-84247] - WB Suggested Anti-RHD Antibody. Titration: 1.0 ug/ml. Positive Control: RPMI-8226 Whole Cell.RHD is strongly supported by BioGPS gene expression data to be expressed in RPMI 8226](http://images.novusbio.com/fullsize2/RHD-Antibody-Western-Blot-NBP2-84247-img0001.jpg "Western Blot: RHD Antibody [NBP2-84247] - WB Suggested Anti-RHD Antibody. Titration: 1.0 ug/ml. Positive Control: RPMI-8226 Whole Cell.RHD is strongly supported by BioGPS gene expression data to be expressed in RPMI 8226")
![Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: 293T. Antibody Dilution: 1.0ug/mlRHD is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells](http://images.novusbio.com/fullsize2/RHD-Antibody-Western-Blot-NBP2-84247-img0002.jpg "Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: 293T. Antibody Dilution: 1.0ug/mlRHD is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells")
![Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/RHD-Antibody-Western-Blot-NBP2-84247-img0003.jpg "Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml")
![Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/RHD-Antibody-Western-Blot-NBP2-84247-img0005.jpg "Western Blot: RHD Antibody [NBP2-84247] - Host: Rabbit. Target Name: RHD. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml")
![Immunohistochemistry: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - Staining of human colon adenocarcinoma (paraffin-embedded sections) with anti-Blood Group Lewis a (7LE).](http://images.novusbio.com/images2/Lewis-A-Blood-Group-Antigen-Antibody-(7LE)-Immunohistochemistry-NB500-525-img0003.jpg)
![Immunohistochemistry-Paraffin: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - Staining of colorectal adenocarcinoma with anti-FUT3/Blood Group Lewis A (7LE).](http://images.novusbio.com/images2/Lewis-A-Blood-Group-Antigen-Antibody-(7LE)-Immunohistochemistry-Paraffin-NB500-525-img0001.jpg)
![Immunohistochemistry-Paraffin: Lewis A Blood Group Antigen Antibody (7LE) [NB500-525] - Staining of human pancreas (paraffin-embedded sections) with anti-Blood Group Lewis a (7LE).](http://images.novusbio.com/images2/Lewis-A-Blood-Group-Antigen-Antibody-(7LE)-Immunohistochemistry-Paraffin-NB500-525-img0002.jpg)
![Immunohistochemistry: Rhodopsin Antibody (B630) [NBP2-25160] - Rhodopsin expression and the prevalence of rod photoreceptors in the canine retina. (A) Fluorescence micrographs showing rhodopsin expression (red) in the ABCA4+/+ (left), ABCA4+/- (middle), and ABCA4-/- (right) rod outer segments. Scale bar = 10 um. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.](http://images.novusbio.com/images2/Rhodopsin-Antibody-(B630)-Immunohistochemistry-NBP2-25160-img0004.jpg)
![Western Blot: Rhodopsin Antibody (B630) [NBP2-25160] - Western blot analyses of ABCA4 (above), GAPDH (middle), and RHO (below) protein levels in retinal tissue of dogs with the three different genotypes. Image collected and cropped by CiteAb from the following publication. 50 ug of protein samples were resolved by SDS-PAGE, transferred to nitrocellulose membrane, and immunoblotted with the following primary antibodies: ABCA4 (NBP1-30032, 1:1000) and Rhodopsin (NBP2-25160, 1:5000), followed by Anti-Mouse IgG horseradish peroxidase-conjugated secondary antibody (R&D Systems, HAF007, 1:5000. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.](http://images.novusbio.com/images2/Rhodopsin-Antibody-(B630)-Western-Blot-NBP2-25160-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (B630) [NBP2-25160] - High magnification confocal image of pig retinal section stained with NBP2-25160 (Green). Rhodopsin is most abundant in the rod outer segments (ROS) of retina, clearly localized in rod membranes. The rod inner segments (RIS) and rod nuclei in the outer nuclear layer (ONL) are also seen in this image. Nuclear DNA was stained with DAPI (blue).](http://images.novusbio.com/images2/Rhodopsin-Antibody-(B630)-Immunocytochemistry-Immunofluorescence-NBP2-25160-img0002.jpg)
![Western Blot: Complement C4b/d Antibody (16D2) [NB200-541] - Western blot analysis of C4 expression in J774.A1 (A) aand mouse PBL (B) whole cell lysates.](http://images.novusbio.com/images2/Complement-C4b-d-Antibody-(16D2)-Western-Blot-NB200-541-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: Calretinin Antibody [NBP1-88220] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/Calretinin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88220-img0011.jpg)
![Western Blot: Calretinin Antibody [NBP1-88220] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/images2/Calretinin-Antibody-Western-Blot-NBP1-88220-img0018.jpg)
![Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in cells in granular layer.](http://images.novusbio.com/images2/Calretinin-Antibody-Immunohistochemistry-Paraffin-NBP1-88220-img0019.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
