Tissue alpha-L-Fucosidase/FUCA1 Antibody

Images

 
Immunohistochemistry: Tissue alpha-L-Fucosidase/FUCA1 Antibody [NBP2-32044] - Immunohistochemical staining of human small intestine shows strong lysosome positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tissue alpha-L-Fucosidase/FUCA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FUCA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Tissue alpha-L-Fucosidase/FUCA1 Protein (NBP2-32044PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tissue alpha-L-Fucosidase/FUCA1 Antibody

  • Alpha-L-fucosidase 1
  • Alpha-L-fucosidase I
  • Alpha-L-fucoside fucohydrolase 1
  • EC 3.2.1
  • EC 3.2.1.51
  • FUCA
  • FUCA1
  • fucosidase, alpha-L- 1, tissue
  • Tissue alphaLFucosidase
  • Tissue alpha-L-Fucosidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3207
Species: Hu, Mu, Rt
Applications: WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
MAB1448
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03734
Species: Hu, Mu, Pm
Applications: WB, Flow, IHC, IHC-P
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-43837
Species: Hu, Mu, Rt, Dr, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044) (0)

There are no publications for Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044) (0)

There are no reviews for Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tissue alpha-L-Fucosidase/FUCA1 Products

Bioinformatics Tool for Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044)

Discover related pathways, diseases and genes to Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044)

Discover more about diseases related to Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044).
 

Pathways for Tissue alpha-L-Fucosidase/FUCA1 Antibody (NBP2-32044)

View related products by pathway.

Blogs on Tissue alpha-L-Fucosidase/FUCA1

There are no specific blogs for Tissue alpha-L-Fucosidase/FUCA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tissue alpha-L-Fucosidase/FUCA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FUCA1
Entrez
Uniprot