RHCE Antibody

Images

 
Immunohistochemistry-Paraffin: RHCE Antibody [NBP3-17923] - Staining of human bone marrow shows strong positivity in hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RHCE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LNLKIWKAPHVAKYFDDQVFWKFPHLAVGF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RHCE
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for RHCE Antibody

  • blood group Rh(CE) polypeptide
  • blood group RhCcEe antigen
  • CD240CE antigen
  • CD240CE
  • MGC103977
  • Rh blood group antigen Evans
  • Rh blood group C antigen
  • Rh blood group, CcEe antigens
  • Rh polypeptide 1
  • Rh polypeptide I
  • RH
  • RH30A
  • Rh4
  • RHC
  • RHCE blood group variant Crawford antigen Rh43
  • RHE
  • Rhesus blood group CE protein
  • Rhesus blood group E antigen
  • Rhesus blood group Rhce antigen
  • Rhesus blood group, CcEe antigens
  • Rhesus C/E antigens
  • Rhesus system C and E polypeptides
  • RhIVb(J)
  • RHIXB
  • RHPI
  • RhVI
  • RhVIII
  • silenced Rh blood group CcEe antigen

Background

The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease. Alternative splicing of this gene results in four transcript variants encoding four different isoforms. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RHCE Antibody (NBP3-17923) (0)

There are no publications for RHCE Antibody (NBP3-17923).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHCE Antibody (NBP3-17923) (0)

There are no reviews for RHCE Antibody (NBP3-17923). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RHCE Antibody (NBP3-17923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RHCE Products

Research Areas for RHCE Antibody (NBP3-17923)

Find related products by research area.

Blogs on RHCE

There are no specific blogs for RHCE, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RHCE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RHCE