NRAS Antibody (6S6F3)

Western Blot: NRAS Antibody (6S6F3) [NBP3-16473] - Analysis of extracts of Rat lung, using NRAS Rabbit mAb (NBP3-16473) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: NRAS Antibody (6S6F3) [NBP3-16473] - Immunofluorescence analysis of U-2 OS cells using NRAS Rabbit mAb (NBP3-16473) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Western Blot: NRAS Antibody (6S6F3) [NBP3-16473] - Analysis of extracts of various cell lines, using NRAS Rabbit mAb (NBP3-16473) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: NRAS Antibody (6S6F3) [NBP3-16473] - Western blot analysis of lysates from Rat lung, using NRAS Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

Immunocytochemistry/ Immunofluorescence: NRAS Antibody (6S6F3) [NBP3-16473] - Confocal imaging of U-2 OS cells using NRAS Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Western Blot: NRAS Antibody (6S6F3) [NRAS] - Western blot analysis of lysates from Rat lung, using NRAS Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.

Immunocytochemistry/ Immunofluorescence: NRAS Antibody (6S6F3) [NRAS] - Confocal imaging of U-2 OS cells using NRAS Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 6S6F3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

NRAS Antibody (6S6F3) Summary

• Description: Novus Biologicals Rabbit NRAS Antibody (6S6F3) (NBP3-16473) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NRAS (P01111). MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQI
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: NRAS
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NRAS Antibody (6S6F3)

• ALPS4
• GTPase NRas
• HRAS1
• neuroblastoma RAS viral (v-ras) oncogene homolog
• N-ras protein part 4
• N-ras
• NRAS1
• NS6
• Transforming protein N-Ras
• v-ras neuroblastoma RAS viral oncogene homolog

Background

Ras (p21), a signal transducer, was first characterized as the transforming genes of Harvey & Kristen sarcoma virus (1). The Ras family (H-Ras, N-Ras, and K-Ras) regulates cell growth, differentiation and apoptosis (2). Switching from an active or resting state, Ras can either bind GTP or GDP respectively. In the triphosphate conformation, Ras will interact with GTPase activating protein (GAP) to increase its activity (3). Mutations in any of the three isoforms can convert these proteins into active oncogenes. Additionally, Ras mutations are found in 30% of all human cancer (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NRAS