NRAS Antibody (6S6F3)

Images

 
Western Blot: NRAS Antibody (6S6F3) [NBP3-16473] - Analysis of extracts of Rat lung, using NRAS Rabbit mAb (NBP3-16473) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. ...read more
Immunocytochemistry/ Immunofluorescence: NRAS Antibody (6S6F3) [NBP3-16473] - Immunofluorescence analysis of U-2 OS cells using NRAS Rabbit mAb (NBP3-16473) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear ...read more
Western Blot: NRAS Antibody (6S6F3) [NBP3-16473] - Analysis of extracts of various cell lines, using NRAS Rabbit mAb (NBP3-16473) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clone
6S6F3
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NRAS Antibody (6S6F3) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NRAS (P01111). MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQI
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
NRAS
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NRAS Antibody (6S6F3)

  • ALPS4
  • GTPase NRas
  • HRAS1
  • neuroblastoma RAS viral (v-ras) oncogene homolog
  • N-ras protein part 4
  • N-ras
  • NRAS1
  • NS6
  • Transforming protein N-Ras
  • v-ras neuroblastoma RAS viral oncogene homolog

Background

Ras (p21), a signal transducer, was first characterized as the transforming genes of Harvey & Kristen sarcoma virus (1). The Ras family (H-Ras, N-Ras, and K-Ras) regulates cell growth, differentiation and apoptosis (2). Switching from an active or resting state, Ras can either bind GTP or GDP respectively. In the triphosphate conformation, Ras will interact with GTPase activating protein (GAP) to increase its activity (3). Mutations in any of the three isoforms can convert these proteins into active oncogenes. Additionally, Ras mutations are found in 30% of all human cancer (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NRAS Antibody (NBP3-16473) (0)

There are no publications for NRAS Antibody (NBP3-16473).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRAS Antibody (NBP3-16473) (0)

There are no reviews for NRAS Antibody (NBP3-16473). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NRAS Antibody (NBP3-16473) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NRAS Products

Research Areas for NRAS Antibody (NBP3-16473)

Find related products by research area.

Blogs on NRAS.

Autophagy and RAS signaling: Clinical implications
By Christina Towers, PhD The cellular recycling process known as autophagy is currently being targeted in over 60 clinical trials focused on treating different types of cancer1. To date, the only autophagy-targeted ...  Read full blog post.

mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRAS Antibody (6S6F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol NRAS