Thrombospondin-2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Thrombospondin-2 Antibody [NBP2-58202] - Staining of human cell line U-2 OS shows localization to nuclear speckles & plasma membrane. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Thrombospondin-2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Thrombospondin-2 Antibody - BSA Free (NBP2-58202) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSNDNQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTICHQITCP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: THBS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Thrombospondin-2 Recombinant Protein Antigen (NBP2-58202PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Thrombospondin-2 Antibody - BSA Free

• THBS2
• thrombospondin 2
• Thrombospondin2
• Thrombospondin-2
• TSP-2
• TSP2thrombospondin-2

Background

Thrombospondin 2 is an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. It can bind to fibrinogen, fibronectin, laminin and type V collagen. This protein has been shown to function as a potent inhibitor of tumor growth and angiogenesis. Studies of the mouse counterpart suggest that this protein may modulate the cell surface properties of mesenchymal cells and be involved in cell adhesion and migration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: THBS2