SUV39H2 Antibody - BSA Free

Chromatin Immunoprecipitation: SUV39H2 Antibody [NBP3-38202] - Chromatin immunoprecipitation analysis of extracts of 293T cell line, using SUV39H2 antibody and rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Western Blot: SUV39H2 Antibody [NBP3-38202] - Western blot analysis of various lysates using SUV39H2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ChIP, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SUV39H2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SUV39H2 Antibody - BSA Free (NBP3-38202) is a polyclonal antibody validated for use in WB, ELISA and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 141-350 of human SUV39H2 (NP_001180354.1).
  
  Sequence:
  CCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SUV39H2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation 5ug antibody for 10ug-15ug of Chromatin
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SUV39H2 Antibody - BSA Free

• FLJ23414Histone H3-K9 methyltransferase 2
• H3-K9-HMTase 2
• histone-lysine N-methyltransferase SUV39H2
• KMT1BEC 2.1.1.43
• Lysine N-methyltransferase 1B
• Su(var)3-9 homolog 2
• suppressor of variegation 3-9 homolog 2 (Drosophila)
• Suppressor of variegation 3-9 homolog 2

Background

Suppressor of variegation 3-9 homolog 2 (Drosophila) is a histone lysine N-methyltransferase activity (H3-K9 specific). This protein contains a SET domain (HMTase activity) and binds chromatin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SUV39H2