PCAF Antibody (5E11)

Images

 
Western Blot: PCAF Antibody (5E11) [H00008850-M04] - Analysis of PCAF expression in A-431 (Cat # L015V1).
Immunocytochemistry/ Immunofluorescence: PCAF Antibody (5E11) [H00008850-M04] - Analysis of monoclonal antibody to PCAF on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: PCAF Antibody (5E11) [H00008850-M04] - Analysis of PCAF expression in LNCaP (Cat # L004V1).
Western Blot: PCAF Antibody (5E11) [H00008850-M04] - Analysis of PCAF expression in Hela S3 NE (Cat # L013V3).
Western Blot: PCAF Antibody (5E11) [H00008850-M04] - Analysis of PCAF expression in human uterus myoma.
Sandwich ELISA: PCAF Antibody (5E11) [H00008850-M04] - Detection limit for recombinant GST tagged PCAF is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
5E11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PCAF Antibody (5E11) Summary

Immunogen
PCAF (AAH60823 353 a.a. - 452 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIPME
Specificity
PCAF (5E11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KAT2B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against tissue lysate, cell lysate and recombinant protein for WB. It has been used for IF and ELISA.
Reviewed Applications
Read 1 Review rated 5
using
H00008850-M04 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCAF Antibody (5E11)

  • CREBBP-associated factor
  • EC 2.3.1.48
  • GCN5
  • GCN5L
  • Histone acetylase PCAF
  • histone acetyltransferase KAT2B
  • Histone acetyltransferase PCAF
  • K(lysine) acetyltransferase 2B
  • KAT2B
  • Lysine acetyltransferase 2B
  • P
  • P/CAFGCN5
  • P300/CBP-associated factorCAF
  • PCAF

Background

CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
NB100-381
Species: Hu
Applications: WB, ChIP, IP
MAB5285
Species: Hu
Applications: WB, Simple Western
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-60052
Species: Hu
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-273
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
NBP2-03993
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for PCAF Antibody (H00008850-M04) (0)

There are no publications for PCAF Antibody (H00008850-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for PCAF Antibody (H00008850-M04) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00008850-M04:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot PCAF H00008850-M04
Enlarge
reviewed by:
Ranveer Singh
WB Human 12/22/2014
View

Summary

ApplicationWestern Blot
Sample TestedWhole cell lysate from HEK 293T cells
SpeciesHuman

Blocking

Blocking Details5% BSA in TBST for 1 h

Primary Anitbody

Dilution Ratio1:1000, Overnight at 4 degree in TBST on a rocker

Secondary Antibody

Secondary DescriptionImmun-Star Goat Anti-Rabbit (GAR)-HRP
Secondary Manufacturer Cat## 170-5046
Secondary Concentration1:20,000 in 5% BSA

Details

Detection NotesECL reagent was used. Exposure for 10 seconds

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PCAF Antibody (H00008850-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PCAF Products

Bioinformatics Tool for PCAF Antibody (H00008850-M04)

Discover related pathways, diseases and genes to PCAF Antibody (H00008850-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCAF Antibody (H00008850-M04)

Discover more about diseases related to PCAF Antibody (H00008850-M04).
 

Pathways for PCAF Antibody (H00008850-M04)

View related products by pathway.

PTMs for PCAF Antibody (H00008850-M04)

Learn more about PTMs related to PCAF Antibody (H00008850-M04).
 

Research Areas for PCAF Antibody (H00008850-M04)

Find related products by research area.

Blogs on PCAF

There are no specific blogs for PCAF, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Ranveer Singh
12/22/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol KAT2B
Entrez
OMIM
Uniprot
COVID-19 update