RIZ1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RIZ1 Antibody [NBP1-89644] - Staining of human cell line U-251MG shows positivity in nucleus and golgi apparatus.
Immunohistochemistry-Paraffin: RIZ1 Antibody [NBP1-89644] - Staining of human gallbladder shows weak cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RIZ1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PPPFQYHHRNPMGIGVTATNFTTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPVPLKQTVQPKNGVVVLDNSGKNAFRRMGQPKRLNFSVELSKMSSNKLKLNALKKKNQLVQKAI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRDM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RIZ1 Protein (NBP1-89644PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RIZ1 Antibody

  • EC 2.1.1.43
  • GATA-3 binding protein G3B
  • GATA-3-binding protein G3B
  • KMT8PR domain-containing protein 2
  • Lysine N-methyltransferase 8
  • MTB-ZFHUMHOXY1
  • PR domain containing 2, with ZNF domain
  • PR domain zinc finger protein 2
  • retinoblastoma protein-binding zinc finger protein
  • Retinoblastoma protein-interacting zinc finger protein
  • RIZ1
  • RIZ2
  • RIZMTE-binding protein
  • Zinc finger protein RIZ
  • zinc-finger DNA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-07799
Species: Hu
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56552
Species: Hu
Applications: WB
AF4885
Species: Mu
Applications: WB, IP

Publications for RIZ1 Antibody (NBP1-89644) (0)

There are no publications for RIZ1 Antibody (NBP1-89644).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIZ1 Antibody (NBP1-89644) (0)

There are no reviews for RIZ1 Antibody (NBP1-89644). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RIZ1 Antibody (NBP1-89644) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RIZ1 Products

Bioinformatics Tool for RIZ1 Antibody (NBP1-89644)

Discover related pathways, diseases and genes to RIZ1 Antibody (NBP1-89644). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RIZ1 Antibody (NBP1-89644)

Discover more about diseases related to RIZ1 Antibody (NBP1-89644).
 

Pathways for RIZ1 Antibody (NBP1-89644)

View related products by pathway.

PTMs for RIZ1 Antibody (NBP1-89644)

Learn more about PTMs related to RIZ1 Antibody (NBP1-89644).
 

Research Areas for RIZ1 Antibody (NBP1-89644)

Find related products by research area.

Blogs on RIZ1

There are no specific blogs for RIZ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RIZ1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM2