SUV39H2 Antibody - BSA Free

Immunohistochemistry-Paraffin: SUV39H2 Antibody [NBP2-38828] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: SUV39H2 Antibody [NBP2-38828] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: SUV39H2 Antibody [NBP2-38828] - Staining in human testis and endometrium tissues using anti-SUV39H2 antibody. Corresponding SUV39H2 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SUV39H2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SUV39H2 Antibody - BSA Free (NBP2-38828) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SUV39H2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SUV39H2 Protein (NBP2-38828PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SUV39H2 Antibody - BSA Free

• FLJ23414Histone H3-K9 methyltransferase 2
• H3-K9-HMTase 2
• histone-lysine N-methyltransferase SUV39H2
• KMT1BEC 2.1.1.43
• Lysine N-methyltransferase 1B
• Su(var)3-9 homolog 2
• suppressor of variegation 3-9 homolog 2 (Drosophila)
• Suppressor of variegation 3-9 homolog 2

Background

Suppressor of variegation 3-9 homolog 2 (Drosophila) is a histone lysine N-methyltransferase activity (H3-K9 specific). This protein contains a SET domain (HMTase activity) and binds chromatin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SUV39H2
• Uniprot:
  • Q9H5I1(Human)