SALL4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SALL4 Antibody [NBP1-85206] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
Immunohistochemistry: SALL4 Antibody [NBP1-85206] - Staining of human ovary shows strong nuclear positivity in follicle cells.
Immunocytochemistry/ Immunofluorescence: SALL4 Antibody [NBP1-85206] - Staining of human cell line CACO-2 shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SALL4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SALL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SALL4 Protein (NBP1-85206PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SALL4 Antibody

  • dJ1112F19.1
  • DRRS
  • HSAL4
  • MGC133050
  • SALL4
  • sal-like 4 (Drosophila)
  • sal-like protein 4
  • Zinc finger protein 797
  • Zinc finger protein SALL4
  • ZNF797
  • ZNF797sal (Drosophila)-like 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
PP-K9814-00
Species: Hu
Applications: WB, IHC, IP
AF2119
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3158
Species: Mu
Applications: WB, ChIP, ICC
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
AF3757
Species: Hu
Applications: WB, ICC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF4847
Species: Hu
Applications: WB, ICC
NBP1-85206
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SALL4 Antibody (NBP1-85206) (0)

There are no publications for SALL4 Antibody (NBP1-85206).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SALL4 Antibody (NBP1-85206) (0)

There are no reviews for SALL4 Antibody (NBP1-85206). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SALL4 Antibody (NBP1-85206) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SALL4 Products

Bioinformatics Tool for SALL4 Antibody (NBP1-85206)

Discover related pathways, diseases and genes to SALL4 Antibody (NBP1-85206). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SALL4 Antibody (NBP1-85206)

Discover more about diseases related to SALL4 Antibody (NBP1-85206).
 

Pathways for SALL4 Antibody (NBP1-85206)

View related products by pathway.

PTMs for SALL4 Antibody (NBP1-85206)

Learn more about PTMs related to SALL4 Antibody (NBP1-85206).

Blogs on SALL4

There are no specific blogs for SALL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SALL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SALL4
Entrez