TBX5 Antibody

Images

 
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human placenta shows moderate nuclear positivity in Hofbauer cells, as well as weaker positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human heart muscle shows strong nuclear positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human lung shows moderate nuclear positivity in a subset of pneumocytes.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBX5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSSYPQQQG
Specificity
Specificity of human TBX5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in scientific literature (PMID:26469858). ICC/IF reactivity reported in scientific literature (PMID: 26469858).
Control Peptide
TBX5 Protein (NBP1-83237PEP)
Publications
Read Publications using
NBP1-83237 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23257984). Mouse reactivity reported in scientific literature (PMID: 26469858).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBX5 Antibody

  • HOS
  • T-box 5
  • T-box protein 5
  • T-box transcription factor TBX5
  • TBX5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31558
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24585
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-85889
Species: Hu
Applications: WB
AF4509
Species: Hu
Applications: WB, ICC
NBP2-46076
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-86846
Species: Hu
Applications: WB, IHC, IHC-P
H00006909-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88644
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00493
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83237
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TBX5 Antibody (NBP1-83237)(3)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(2)
All Species
Showing Publications 1 - 3 of 3.
Publications using NBP1-83237 Applications Species
Sun W, Ramirez S, Spiller K et al. Nf2 fine-tunes proliferation and tissue alignment during closure of the optic fissure in the embryonic mouse eye bioRxiv Jun 29 2020 (IHC, Mouse) IHC Mouse
Kokkinopoulos I, Ishida H, Saba R et al. Single-Cell Expression Profiling Reveals a Dynamic State of Cardiac Precursor Cells in the Early Mouse Embryo. PLoS One 2015 [PMID: 26469858] (WB, ICC/IF, Mouse) WB, ICC/IF Mouse
Lian X, Zhang J, Azarin SM et al. Directed cardiomyocyte differentiation from human pluripotent stem cells by modulating Wnt/-beta-catenin signaling under fully defined conditions. Nat Protoc 2013 Jan [PMID: 23257984]

Reviews for TBX5 Antibody (NBP1-83237) (0)

There are no reviews for TBX5 Antibody (NBP1-83237). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TBX5 Antibody (NBP1-83237) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TBX5 Products

Bioinformatics Tool for TBX5 Antibody (NBP1-83237)

Discover related pathways, diseases and genes to TBX5 Antibody (NBP1-83237). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBX5 Antibody (NBP1-83237)

Discover more about diseases related to TBX5 Antibody (NBP1-83237).
 

Pathways for TBX5 Antibody (NBP1-83237)

View related products by pathway.

PTMs for TBX5 Antibody (NBP1-83237)

Learn more about PTMs related to TBX5 Antibody (NBP1-83237).

Blogs on TBX5

There are no specific blogs for TBX5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBX5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX5