Home » TBX5 » TBX5 Antibodies » TBX5 Antibody

TBX5 Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human placenta shows moderate nuclear positivity in Hofbauer cells, as well as weaker positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human placenta shows moderate nuclear positivity in Hofbauer cells, as well as weaker positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human heart muscle shows strong nuclear positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human lung shows moderate nuclear positivity in a subset of pneumocytes.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining in human heart muscle and pancreas tissues. Corresponding TBX5 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TBX5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSSYPQQQG
Specificity
Specificity of human, mouse TBX5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Western Blot reactivity reported in scientific literature (PMID:26469858). ICC/IF reactivity reported in scientific literature (PMID: 26469858).
Control Peptide
TBX5 Protein (NBP1-83237PEP)
Publications
Read Publications using
NBP1-83237 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23257984). Mouse reactivity reported in scientific literature (PMID: 26469858).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBX5 Antibody

  • HOS
  • T-box 5
  • T-box protein 5
  • T-box transcription factor TBX5
  • TBX5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NKX2.5 Antibody
NBP1-31558
Western Blot: NKX2.5 Antibody [NBP1-31558] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Nkx2.5 antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: NKX2.5 Antibody [NBP1-31558] - Paraformaldehyde-fixed mouse ESC D3, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: NKX2.5 Antibody [NBP1-31558] - Paraffin-embedded rat heart. Nkx2.5 stained by Nkx2.5 antibody diluted at 1:500.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
GATA-4 Antibody
NBP2-24585
Western Blot: GATA-4 Antibody [NBP2-24585] - Analysis of GATA-4 in human kidney lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: GATA-4 Antibody [NBP2-24585] - Formalin-fixed, paraffin-embedded human brain (cortex) probed with GATA-4 antibody at 10 ug/ml.
Immunohistochemistry-Paraffin: GATA-4 Antibody [NBP2-24585] - Formalin-fixed, paraffin-embedded human prostate probed with GATA-4 antibody at 10 ug/ml.
(1 Review)
Species: Hu
Applications: WB, IHC-P
BMP-4
[Unconjugated]
314-BP
1 ug/lane of Recombinant Human BMP-4 was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 22-25 kDa and 37-41 kDa, respectively. Multiple bands in gel are due to variable glycosylation. 
Recombinant Human BMP-4 (Catalog #314-BP/CF) induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 2.5-15 ng/mL.
(3 Reviews)
(265 Publications)
Species: Hu
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(492 Publications)
Species: Hu
TBX4 Antibody
NBP2-58490
Immunocytochemistry/Immunofluorescence: TBX4 Antibody [NBP2-58490] - Staining of human cell line U-2 OS shows localization to vesicles.
Species: Hu
Applications: ICC/IF
TBX3 Antibody
AF4509
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and Daudi human Burkitt's lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human TBX3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4509) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for TBX3 at approximately 80 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
(1 Review)
Species: Hu
Applications: WB, ICC
TBX1 Antibody
(OTI1C2)
NBP2-46076
Western Blot: TBX1 Antibody (1C2) [NBP2-46076] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TBX1.
Immunohistochemistry: TBX1 Antibody (1C2) [NBP2-46076] - Analysis of Human lymph node tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu
Applications: WB, IHC
Atrial Natriuretic
Peptide/ANP Antibody
NBP2-14873
Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Mouse tissue extracts (50 ug) was separated by 15 % SDS-PAGE, and the membrane was blotted with ANP antibody diluted by 1:5000.
Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Paraffin-embedded mouse muscle. ANP antibody [N1C3] ) diluted at 1:500.
Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Rat tissue extract (50 ug) was separated by 15% SDS-PAGE, and the membrane was blotted with ANP antibody [N1C3] diluted at 1:2000.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
TBX20 Antibody
(668710)
MAB8124
TBX20 was detected in immersion fixed BG01V human embryonic stem cells differentiated to cardiac cells using Mouse Anti-Human TBX20 Monoclonal Antibody (Catalog # MAB8124) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
Species: Hu
Applications: ICC
FGF-10
[Unconjugated]
345-FG/CF
1 μg/lane of Recombinant Human FGF-10 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 21 kDa.
Recombinant Human FGF-10 (Catalog # 345-FG/CF) stimulates cell proliferation of the 4MBr‑5 rhesus monkey epithelial cell line. The ED50 for this effect is 20‑100 ng/mL.
(40 Publications)
Species: Hu
Sonic Hedgehog/Shh
[Unconjugated]
461-SH/CF
1 μg/lane of Recombinant Mouse Sonic Hedgehog/Shh, N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 23 kDa.
Recombinant Mouse Sonic Hedgehog/Shh, N-Terminus (Catalog # 461-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.6‑3 μg/mL.
(25 Publications)
Species: Mu
TBX2 Antibody
NBP1-89459
Immunocytochemistry/Immunofluorescence: TBX2 Antibody [NBP1-89459] - Staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TBX2 Antibody [NBP1-89459] - Staining of human stomach shows strong nuclear and cytoplasmic positivity in glandular cells.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
PITX1 Antibody
NBP1-88644
Immunocytochemistry/Immunofluorescence: PITX1 Antibody [NBP1-88644] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.
Immunohistochemistry-Paraffin: PITX1 Antibody [NBP1-88644] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MEF2C Antibody
(OTI1H5)
NBP2-00493
Western Blot: MEF2C Antibody (1H5) [NBP2-00493] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MEF2C (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MEF2C.
Immunocytochemistry/Immunofluorescence: MEF2C Antibody (1H5) [NBP2-00493] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY MEF2C.
Immunohistochemistry-Paraffin: MEF2C Antibody (1H5) [NBP2-00493] - Staining of paraffin-embedded Human Ovary tissue using anti-MEF2C mouse monoclonal antibody.
(1 Publication)
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: Lane 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with Dylight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - IHC analysis of a formalin fixed paraffin embedded tissue section of mouse spleen using CD4 antibody at 1:300 dilution with HRP-DAB detection and hematoxylin counterstaining. The antibody generated a strong signal in the membranes of a subset of cells in the spleen section and the staining showed punctate appearance in some cells.
(6 Reviews)
(13 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
CCR5 Antibody
(45531)
MAB182
CCR5 was detected in immersion fixed human dendritic cells using Human CCR5 Monoclonal Antibody (Catalog # MAB182) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Recombinant Human CCL3/MIP‑1 alpha (Catalog # 270-LD) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CCR5 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human CCL3/MIP‑1 alpha (40 ng/mL) is neutralized (green line) by increasing concentrations of Human CCR5 Monoclonal Antibody (Catalog # MAB182). The ND50 is typically 5-20 µg/mL.
(22 Publications)
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
Osteocalcin
Antibody (190125)
MAB1419
Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Osteocalcin was detected in immersion fixed MG‑63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(18 Publications)
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
p19ARF Antibody
NB200-106
Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - IHC analysis of formalin fixed paraffin-embedded (FFPE) mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(1 Review)
(40 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for TBX5 Antibody (NBP1-83237)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for TBX5 Antibody (NBP1-83237) (0)

There are no reviews for TBX5 Antibody (NBP1-83237). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TBX5 Antibody (NBP1-83237) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TBX5 Products

Bioinformatics Tool for TBX5 Antibody (NBP1-83237)

Discover related pathways, diseases and genes to TBX5 Antibody (NBP1-83237). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBX5 Antibody (NBP1-83237)

Discover more about diseases related to TBX5 Antibody (NBP1-83237).
 

Pathways for TBX5 Antibody (NBP1-83237)

View related products by pathway.

PTMs for TBX5 Antibody (NBP1-83237)

Learn more about PTMs related to TBX5 Antibody (NBP1-83237).

Blogs on TBX5

There are no specific blogs for TBX5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBX5 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TBX5
Entrez