Home » TBX5 » TBX5 Antibodies » TBX5 Antibody

TBX5 Antibody

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human placenta shows moderate nuclear positivity in Hofbauer cells, as well as weaker positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human placenta shows moderate nuclear positivity in Hofbauer cells, as well as weaker positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human heart muscle shows strong nuclear positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human lung shows moderate nuclear positivity in a subset of pneumocytes.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TBX5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSSYPQQQG
Specificity
Specificity of human TBX5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in scientific literature (PMID:26469858). ICC/IF reactivity reported in scientific literature (PMID: 26469858).
Control Peptide
TBX5 Protein (NBP1-83237PEP)
Publications
Read Publications using
NBP1-83237 in the following applications:

  • ICC/IF
    1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23257984). Mouse reactivity reported in scientific literature (PMID: 26469858).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBX5 Antibody

  • HOS
  • T-box 5
  • T-box protein 5
  • T-box transcription factor TBX5
  • TBX5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NKX2.5 Antibody
NBP1-31558
Western Blot: NKX2.5 Antibody [NBP1-31558] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Nkx2.5 antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: NKX2.5 Antibody [NBP1-31558] - Paraformaldehyde-fixed mouse ESC D3, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: NKX2.5 Antibody [NBP1-31558] - Rat heart. Nkx2.5 stained by Nkx2.5 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
GATA-4 Antibody
NBP2-24585
Western Blot: GATA-4 Antibody [NBP2-24585] - Analysis of GATA-4 in human kidney lysate in the 1) absence and 2) presence of immunizing peptide using this antibody. I goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: GATA-4 Antibody [NBP2-24585] - Staining in human pancreatic tissue stained for GATA4 (green), nuclear localization.
Immunohistochemistry-Paraffin: GATA-4 Antibody [NBP2-24585] - Formalin-fixed, paraffin-embedded human prostate probed with GATA-4 antibody at 10 ug/ml.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
BMP-4
[Unconjugated]
314-BP
1 ug/lane of Recombinant Human BMP-4 was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 22-25 kDa and 37-41 kDa, respectively. Multiple bands in gel are due to variable glycosylation. 
Recombinant Human BMP-4 (Catalog #314-BP/CF) induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 2.5-15 ng/mL.
(8 Reviews)
(365 Publications)
Species: Hu
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(35 Reviews)
(649 Publications)
Species: Hu
TBX4 Antibody
NBP2-85889
Western Blot: TBX4 Antibody [NBP2-85889] - WB Suggested Anti-TBX4 Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate
Western Blot: TBX4 Antibody [NBP2-85889] - Host: Rabbit. Target: TBX4. Positive control (+): Human lung (LU). Negative control (-): MCF7 (N10). Antibody concentration: 1ug/ml
Western Blot: TBX4 Antibody [NBP2-85889] - Host: Rabbit. Target Name: TBX4. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 2ug/ml
Species: Hu
Applications: WB
TBX3 Antibody
[Unconjugated]
AF4509
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and Daudi human Burkitt's lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human TBX3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4509) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for TBX3 at approximately 80 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
TBX3 was detected in immersion fixed LNCaP human prostate cancer cell line using Goat Anti-Human TBX3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4509) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
Species: Hu
Applications: WB, ICC
TBX1 Antibody
(OTI1C2)
NBP2-46076
Western Blot: TBX1 Antibody (OTI1C2) [NBP2-46076] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TBX1.
Immunohistochemistry-Paraffin: TBX1 Antibody (OTI1C2) [NBP2-46076] - Analysis of Human lymph node tissue. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Atrial Natriuretic
Peptide/ANP Antibody
NBP2-14873
Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Knockdown of ATE1 attenuates cardiac hypertrophy. Western blot analysis of ANP protein levels in heart samples from sham and renal ligated rats (B2) bar graph was generated by quantifying the blots and normalizing the intensities of bands to the untreated lane (C) BNP and (D) beta-MHC in Ligated ATE1 siRNA when compared with Ligated NS siRNA samples. Statistical analysis was carried out by one-way ANOVA. Data are represented as mean +/- SE. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-57379-7) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Mouse heart. ANP stained by ANP antibody [N1C3] diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Rat tissue extract (50 ug) was separated by 15% SDS-PAGE, and the membrane was blotted with ANP antibody [N1C3] diluted at 1:2000.
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
TBX20 Antibody
NBP2-86846
Western Blot: TBX20 Antibody [NBP2-86846] - Host: Rabbit. Target Name: TBX20. Sample Tissue: Human HepG2. Antibody Dilution: 1.0ug/ml
Immunohistochemistry: TBX20 Antibody [NBP2-86846] - Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-TBX20 antibody
Western Blot: TBX20 Antibody [NBP2-86846] - Host: Rabbit. Target Name: TBX20. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 2ug/ml
Species: Hu
Applications: WB, IHC, IHC-P
FGF-10
[Unconjugated]
345-FG
1 μg/lane of Recombinant Human FGF-10 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 21 kDa.
Recombinant Human FGF-10 (Catalog # 345-FG) stimulates cell proliferation of the 4MBr‑5 rhesus monkey epithelial cell line. The ED50 for this effect is 20‑100 ng/mL.
(1 Review)
(63 Publications)
Species: Hu
Sonic Hedgehog/Shh
[Unconjugated]
464-SH/CF
Recombinant Mouse Sonic Hedgehog/Shh (C25Il), N-Terminus (Catalog # 464-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The activity is more than 30-fold greater than the top competitor's Sonic Hedgehog.
1 μg/lane of Recombinant Mouse Sonic Hedgehog/Shh (C25Il), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
(38 Publications)
Species: Mu
TBX2 Antibody (7G5)
H00006909-M01
Western Blot: TBX2 Antibody (7G5) [H00006909-M01] - TBX2 monoclonal antibody (M01), clone 7G5 Analysis of TBX2 expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: TBX2 Antibody (7G5) [H00006909-M01] - Analysis of monoclonal antibody to TBX2 on HeLa cell. Antibody concentration 30 ug/ml.
Western Blot: TBX2 Antibody (7G5) [H00006909-M01] - Analysis of TBX2 over-expressed 293 cell line, cotransfected with TBX2 Validated Chimera RNAi ( Cat # H00006909-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TBX2 monoclonal antibody (M01), clone 7G5 (Cat # H00006909-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
Connexin 40/GJA5
Antibody
NBP1-46568
Immunohistochemistry-Paraffin: Connexin 40/GJA5 Antibody [NBP1-46568] - IHC on paraffin sections of rat kidney tissue using Rabbit antibody to Connexin 40. HIER: 1 mM EDTA, pH 8 for 20 min. Blocking: 0.2% LFDM in TBST filtered thru 0.2 um. Detection was done using Novolink HRP polymer from Leica following manufactures instructions. Primary antibody: dilution 1: 1000, incubated 30 min at RT (using Autostainer. Sections were counterstained with Harris Hematoxylin.
Immunohistochemistry-Paraffin: Connexin 40/GJA5 Antibody [NBP1-46568] - IHC on paraffin sections of rat kidney tissue using Rabbit antibody to Connexin 40. HIER: 1 mM EDTA, pH 8 for 20 min. Blocking: 0.2% LFDM in TBST filtered thru 0.2 um. Detection was done using Novolink HRP polymer from Leica following manufactures instructions. Primary antibody: dilution 1: 1000, incubated 30 min at RT (using Autostainer. Sections were counterstained with Harris Hematoxylin.
Species: Mu, Rt
Applications: WB, IHC, IHC-P
PITX1 Antibody
NBP1-88644
Immunocytochemistry/Immunofluorescence: PITX1 Antibody [NBP1-88644] - Staining of human cell line U-2 OS shows localization to nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PITX1 Antibody [NBP1-88644] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: PITX1 Antibody [NBP1-88644] - Saining of human esophagus shows moderate to strong nuclear positivity in squamous epithelial cells.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
MEF2C Antibody
(OTI1H5)
NBP2-00493
Western Blot: MEF2C Antibody (1H5) [NBP2-00493] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MEF2C (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MEF2C.
Immunocytochemistry/Immunofluorescence: MEF2C Antibody (OTI1H5) [NBP2-00493] - MEF2C Antibody (1H5) [NBP2-00493] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY MEF2C.
Immunohistochemistry-Paraffin: MEF2C Antibody (1H5) [NBP2-00493] - Staining of paraffin-embedded Human Ovary tissue using anti-MEF2C mouse monoclonal antibody.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CD4 Antibody
NBP1-19371
Immunohistochemistry: CD4 Antibody [NBP1-19371] - Increased CD3+ and CD4+ T-cell occurrence in the brainstem of SHR-72 transgenic rat model for tauopathies. (A-D) Immunofluorescence staining showed CD4+ T-cells in SHR-72 transgenic animals. (E- H) Immunofluorescence staining showed more perivascular than brain parenchyma infiltrating CD4+ T-cells in SHR-72 transgenic animals. PLoS One. 2019 May 23;14(5):e0217216. doi: 10.1371/journal.pone.0217216.
Immunohistochemistry: CD4 Antibody [NBP1-19371] - DBZ inhibits the accumulation of CD4+ T cells and Th2 differentiation in the AAAs. (B) The representation of immunohistochemical staining for CD4+ in abdominal aorta from four groups (left). Bar graphs show the percentage of CD4+ positive cell areas (right; n=3 per group). Bar: 50 um.
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
(9 Reviews)
(29 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
CCR5 Antibody
(45531) [Unconjugated
MAB182
Human peripheral blood mononuclear cells (PBMCs) were stained with either (A) Mouse Anti-Human CCR5 Monoclonal Antibody (Catalog # MAB182) or (B) Mouse IgG2B Isotype Control (Catalog # MAB0041) followed by Goat anti-Mouse IgG APC-conjugated Secondary Antibody (Catalog # F0101B) and Mouse Anti-Human CD3 epsilon PE-conjugated Monoclonal Antibody (Catalog # FAB100P). View our protocol for Staining Membrane-associated Proteins.
Recombinant Human CCL3/MIP‑1 alpha (Catalog # 270-LD) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CCR5 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human CCL3/MIP‑1 alpha (40 ng/mL) is neutralized (green line) by increasing concentrations of Human CCR5 Monoclonal Antibody (Catalog # MAB182). The ND50 is typically 5-20 µg/mL.
CCR5 was detected in immersion fixed human dendritic cells using Human CCR5 Monoclonal Antibody (Catalog # MAB182) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Review)
(24 Publications)
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
Osteocalcin
Antibody (190125)
MAB1419
Saos‑2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(23 Publications)
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(42 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
TBX5 Antibody
NBP1-83237
TBX5 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TBX5 Antibody (NBP1-83237)(3)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(2)
All Species
Showing Publications 1 - 3 of 3.
Publications using NBP1-83237 Applications Species
Sun W, Ramirez S, Spiller K et al. Nf2 fine-tunes proliferation and tissue alignment during closure of the optic fissure in the embryonic mouse eye bioRxiv Jun 29 2020 (IHC, Mouse) IHC Mouse
Kokkinopoulos I, Ishida H, Saba R et al. Single-Cell Expression Profiling Reveals a Dynamic State of Cardiac Precursor Cells in the Early Mouse Embryo. PLoS One 2015 [PMID: 26469858] (WB, ICC/IF, Mouse) WB, ICC/IF Mouse
Lian X, Zhang J, Azarin SM et al. Directed cardiomyocyte differentiation from human pluripotent stem cells by modulating Wnt/-beta-catenin signaling under fully defined conditions. Nat Protoc 2013 Jan [PMID: 23257984]

Reviews for TBX5 Antibody (NBP1-83237) (0)

There are no reviews for TBX5 Antibody (NBP1-83237). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TBX5 Antibody (NBP1-83237) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional TBX5 Products

Bioinformatics Tool for TBX5 Antibody (NBP1-83237)

Discover related pathways, diseases and genes to TBX5 Antibody (NBP1-83237). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBX5 Antibody (NBP1-83237)

Discover more about diseases related to TBX5 Antibody (NBP1-83237).
 

Pathways for TBX5 Antibody (NBP1-83237)

View related products by pathway.

PTMs for TBX5 Antibody (NBP1-83237)

Learn more about PTMs related to TBX5 Antibody (NBP1-83237).

Blogs on TBX5

There are no specific blogs for TBX5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBX5 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TBX5