TBX5 Antibody

Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human placenta shows moderate nuclear positivity in Hofbauer cells, as well as weaker positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human heart muscle shows strong nuclear positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human lung shows moderate nuclear positivity in a subset of pneumocytes.

Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TBX5 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSSYPQQQG
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBX5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in scientific literature (PMID:26469858). ICC/IF reactivity reported in scientific literature (PMID: 26469858).
• Control Peptide:

  TBX5 Protein (NBP1-83237PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23257984). Mouse reactivity reported in scientific literature (PMID: 26469858).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TBX5 Antibody

• HOS
• T-box 5
• T-box protein 5
• T-box transcription factor TBX5
• TBX5

Background

TBX5 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TBX5 Antibody (NBP1-83237)(4)

Publications using NBP1-83237

• Yamasaki S, Kuwahara A, Kishino A et al. Addition of Chk1 inhibitor and BMP4 cooperatively promotes retinal tissue formation in self-organizing human pluripotent stem cell differentiation culture Regenerative Therapy Mar 1 2022 [PMID: 35059477] (IHC, Human)
• Sun W, Ramirez S, Spiller K et al. Nf2 fine-tunes proliferation and tissue alignment during closure of the optic fissure in the embryonic mouse eye Hum Mol Genet Oct 19 2020 [PMID: 33075808]
• Kokkinopoulos I, Ishida H, Saba R et al. Single-Cell Expression Profiling Reveals a Dynamic State of Cardiac Precursor Cells in the Early Mouse Embryo. PLoS One 2015 [PMID: 26469858] (WB, ICC/IF, Mouse)
• Lian X, Zhang J, Azarin SM et al. Directed cardiomyocyte differentiation from human pluripotent stem cells by modulating Wnt/-beta-catenin signaling under fully defined conditions. Nat Protoc 2013 Jan [PMID: 23257984]

Bioinformatics

• Gene Symbol: TBX5