TBX5 Antibody

Images

 
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human placenta shows moderate nuclear positivity in Hofbauer cells, as well as weaker positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human heart muscle shows strong nuclear positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human lung shows moderate nuclear positivity in a subset of pneumocytes.
Immunohistochemistry-Paraffin: TBX5 Antibody [NBP1-83237] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBX5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSSYPQQQG
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in scientific literature (PMID:26469858). ICC/IF reactivity reported in scientific literature (PMID: 26469858).
Control Peptide
TBX5 Protein (NBP1-83237PEP)
Publications
Read Publications using
NBP1-83237 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23257984). Mouse reactivity reported in scientific literature (PMID: 26469858).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBX5 Antibody

  • HOS
  • T-box 5
  • T-box protein 5
  • T-box transcription factor TBX5
  • TBX5

Background

TBX5 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2444
Species: Hu
Applications: IHC, WB
NBP2-24585
Species: Hu, Mu
Applications: IHC, IHC-P, WB
314-BP/CF
Species: Hu
Applications: BA, BA
210-TA
Species: Hu
Applications: BA
NBP2-85889
Species: Hu
Applications: WB
AF4509
Species: Hu
Applications: ICC, WB
NBP2-46076
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-86846
Species: Hu
Applications: IHC, IHC-P, WB
345-FG/CF
Species: Hu
Applications: BA
1845-SH/CF
Species: Hu
Applications: BA
H00006909-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
H00005307-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, KD, S-ELISA, WB
NBP2-17260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB182
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for TBX5 Antibody (NBP1-83237)(4)

Reviews for TBX5 Antibody (NBP1-83237) (0)

There are no reviews for TBX5 Antibody (NBP1-83237). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TBX5 Antibody (NBP1-83237) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TBX5 Products

Bioinformatics Tool for TBX5 Antibody (NBP1-83237)

Discover related pathways, diseases and genes to TBX5 Antibody (NBP1-83237). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBX5 Antibody (NBP1-83237)

Discover more about diseases related to TBX5 Antibody (NBP1-83237).
 

Pathways for TBX5 Antibody (NBP1-83237)

View related products by pathway.

PTMs for TBX5 Antibody (NBP1-83237)

Learn more about PTMs related to TBX5 Antibody (NBP1-83237).

Blogs on TBX5

There are no specific blogs for TBX5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBX5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX5