Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ICC/IF, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MSRMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVSGPSQDLLPPPNPYPLPQEHSQIYHCTKRKEEECSTTDHPYKKPYMETSPSEEDSFYRSSYPQQQG |
Specificity | Specificity of human TBX5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Predicted Species | Rat (92%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | TBX5 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in scientific literature (PMID:26469858). ICC/IF reactivity reported in scientific literature (PMID: 26469858). |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-83237 | Applications | Species |
---|---|---|
Sun W, Ramirez S, Spiller K et al. Nf2 fine-tunes proliferation and tissue alignment during closure of the optic fissure in the embryonic mouse eye bioRxiv Jun 29 2020 (IHC, Mouse) | IHC | Mouse |
Kokkinopoulos I, Ishida H, Saba R et al. Single-Cell Expression Profiling Reveals a Dynamic State of Cardiac Precursor Cells in the Early Mouse Embryo. PLoS One 2015 [PMID: 26469858] (WB, ICC/IF, Mouse) | WB, ICC/IF | Mouse |
Lian X, Zhang J, Azarin SM et al. Directed cardiomyocyte differentiation from human pluripotent stem cells by modulating Wnt/-beta-catenin signaling under fully defined conditions. Nat Protoc 2013 Jan [PMID: 23257984] |
Secondary Antibodies |
Isotype Controls |
Diseases for TBX5 Antibody (NBP1-83237)Discover more about diseases related to TBX5 Antibody (NBP1-83237).
| Pathways for TBX5 Antibody (NBP1-83237)View related products by pathway.
|
PTMs for TBX5 Antibody (NBP1-83237)Learn more about PTMs related to TBX5 Antibody (NBP1-83237).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | TBX5 |