SALL1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SALL1 Antibody [NBP2-13275] - Staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SALL1 Antibody [NBP2-13275] - Staining of human thyroid gland shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SALL1 Antibody [NBP2-13275] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: SALL1 Antibody [NBP2-13275] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: SALL1 Antibody [NBP2-13275] - Staining of human endometrium shows moderate to strong nuclear positivity in glandular cells.

Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.

Staining of human testis shows moderate nuclear positivity in Leydig cells and cells in seminiferous ducts.

Staining of human kidney shows moderate nucleus positivity in cells in tubules.

Staining of human thyroid gland shows strong nuclear positivity in glandular cells.

ChIP-Exo-Seq composite graph for Anti-SALL1 (NBP2-13275) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SALL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SALL1 Antibody - BSA Free (NBP2-13275) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: TLPSLIPFIKTEEPAPIPISHSATSPPGSVKSDSGGPESATRNLGGLPEEAEGSTLPPSGGKSEESGMVTNSVPT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SALL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SALL1 Protein (NBP2-13275PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SALL1 Antibody - BSA Free

• HSAL1
• sal (Drosophila)-like 1
• SAL1
• Sal-1
• SALL1
• sal-like 1 (Drosophila)
• sal-like protein 1
• Spalt-like transcription factor 1
• Zinc finger protein 794
• Zinc finger protein SALL1
• Zinc finger protein Spalt-1
• ZNF794TBS

Background

The protein encoded by the SALL1 gene is a zinc finger transcriptional repressor and may be part of the NuRD histone deacetylase complex (HDAC). Defects in this gene are a cause of Townes-Brocks syndrome (TBS) as well as bronchio-oto-renal syndrome (BOR). Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SALL1