S100A6 Antibody

Images

 
Orthogonal Strategies: Western Blot: S100A6 Antibody [NBP1-89388] - Analysis in human cell lines PC-3 and HEK293 using anti-S100A6 antibody. Corresponding S100A6 RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: S100A6 Antibody [NBP1-89388] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human urinary bladder shows moderate cytoplasmic and nuclear positivity in urothelial cells.
Western Blot: S100A6 Antibody [NBP1-89388] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human kidney shows moderate cytoplasmic positivity in cells in distal tubules and in glomeruli.
Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

S100A6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNE
Specificity
Specificity of human S100A6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100A6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
Control
S100A6 Knockout HeLa Cell Lysate
Control Peptide
S100A6 Recombinant Protein Antigen (NBP1-89388PEP)
Publications
Read Publications using
NBP1-89388 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Mouse, Human reactivity reported in scientific literature (PMID: 26658462).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for S100A6 Antibody

  • 2A9
  • CABP
  • CACY
  • CACY5B10
  • calcyclin
  • Growth factor-inducible protein 2A9
  • MLN 4
  • PRA
  • PRAS100 calcium binding protein A6 (calcyclin)
  • Prolactin receptor-associated protein
  • protein S100-A6
  • S100 calcium binding protein A6
  • S100 calcium-binding protein A6 (calcyclin)
  • S100 calcium-binding protein A6
  • S100A6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-45267
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-23368
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-57362
Species: Hu
Applications: WB, ICC/IF
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for S100A6 Antibody (NBP1-89388)(3)

Reviews for S100A6 Antibody (NBP1-89388) (0)

There are no reviews for S100A6 Antibody (NBP1-89388). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for S100A6 Antibody (NBP1-89388) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional S100A6 Products

Bioinformatics Tool for S100A6 Antibody (NBP1-89388)

Discover related pathways, diseases and genes to S100A6 Antibody (NBP1-89388). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A6 Antibody (NBP1-89388)

Discover more about diseases related to S100A6 Antibody (NBP1-89388).
 

Pathways for S100A6 Antibody (NBP1-89388)

View related products by pathway.

PTMs for S100A6 Antibody (NBP1-89388)

Learn more about PTMs related to S100A6 Antibody (NBP1-89388).
 

Research Areas for S100A6 Antibody (NBP1-89388)

Find related products by research area.

Blogs on S100A6.

S100A6: Playing Roles in Cancer, Apoptosis & Transcription Regulation
S100A6 antibodies detect a small calcium binding protein with 2 EF-hand structures and belongs to the S100 family. Calcium binding induces a conformational change of the protein which in turn permits its interaction with several target proteins. It is...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A6