S100A6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: S100A6 Antibody [NBP1-89388] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human urinary bladder shows moderate cytoplasmic and nuclear positivity in urothelial cells.

Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human kidney shows moderate cytoplasmic positivity in cells in distal tubules and in glomeruli.

Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human liver shows no positivity in hepatocytes as expected.

Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.

Analysis in human cell lines PC-3 and HEK293 using Anti-S100A6 antibody. Corresponding S100A6 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

S100A6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: S100A6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
• Control Peptide:

  S100A6 Recombinant Protein Antigen (NBP1-89388PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for S100A6 Antibody - BSA Free

• 2A9
• CABP
• CACY
• CACY5B10
• calcyclin
• Growth factor-inducible protein 2A9
• MLN 4
• PRA
• PRAS100 calcium binding protein A6 (calcyclin)
• Prolactin receptor-associated protein
• protein S100-A6
• S100 calcium binding protein A6
• S100 calcium-binding protein A6 (calcyclin)
• S100 calcium-binding protein A6
• S100A6

Background

S100A6 is a member of the S100 family of proteins, and may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Recent studies have found that S100A6 is induced by tumour necrosis factor-alpha via a NF-kappaB-dependent mechanism, which serves a role in limiting tumour necrosis factor-alpha-induced apoptosis by regulating p53 phosphorylation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for S100A6 Antibody (NBP1-89388)(8)

Publications using NBP1-89388

• Schartz ND, Liang HY, Carvalho K et Al. C5aR1 antagonism suppresses inflammatory glial responses and alters cellular signaling in an Alzheimer's disease mouse model Nat Commun 2024-08-15 [PMID: 39147742]
• Schartz ND, Liang HY, Carvalho K et al. C5aR1 antagonism suppresses inflammatory glial gene expression and alters cellular signaling in an aggressive Alzheimer's model bioRxiv 2023-08-27 [PMID: 37662399] (Immunohistochemistry, Human, Mouse)
• Derk J, Como CN, Jones HE et al. Formation and function of the meningeal arachnoid barrier around the developing mouse brain Developmental cell 2023-03-22 [PMID: 36996816]
• Jones HE, Abrams KA, Siegenthaler JA Techniques for visualizing fibroblast-vessel interactions in the developing and adult CNS Neurophotonics 2022-04-01 [PMID: 35402637]
• Driskill JH, Zheng Y, Wu BK et al. WWTR1(TAZ)-CAMTA1 reprograms endothelial cells to drive epithelioid hemangioendothelioma Genes & development 2021-04-01 [PMID: 33766984]
• DeSisto J, O'Rourke R, Jones HE et al. Single-Cell Transcriptomic Analyses of the Developing Meninges Reveal Meningeal Fibroblast Diversity and Function Dev. Cell 2020-07-06 [PMID: 32634398]
• Tian ZY, Wang CY, Wang T et al. Glial S100A6 Degrades beta-amyloid Aggregation through Targeting Competition with Zinc Ions Aging Dis 2019-08-01 [PMID: 31440382] (ICC/IF, WB, Mouse)
• Mehdi Damaghi, Narges K. Tafreshi, Mark C. Lloyd et al. Chronic acidosis in the tumour microenvironment selects for overexpression of LAMP2 in the plasma membrane. Nature Communications 2015-01-01 [PMID: 26658462] (IF/IHC, Human, Mouse)

Bioinformatics

• Gene Symbol: S100A6