We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

S100A6 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: S100A6 Antibody [NBP1-89388] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human urinary bladder shows moderate cytoplasmic and nuclear positivity in urothelial cells.
Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human kidney shows moderate cytoplasmic positivity in cells in distal tubules and in glomeruli.
Immunohistochemistry-Paraffin: S100A6 Antibody [NBP1-89388] - Staining of human liver shows no positivity in hepatocytes as expected.
Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Orthogonal Strategies: Analysis in human cell lines PC-3 and HEK293 using Anti-S100A6 antibody. Corresponding S100A6 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

S100A6 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
S100A6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
Control Peptide
S100A6 Recombinant Protein Antigen (NBP1-89388PEP)
Publications
Read Publications using
NBP1-89388 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for S100A6 Antibody - BSA Free

  • 2A9
  • CABP
  • CACY
  • CACY5B10
  • calcyclin
  • Growth factor-inducible protein 2A9
  • MLN 4
  • PRA
  • PRAS100 calcium binding protein A6 (calcyclin)
  • Prolactin receptor-associated protein
  • protein S100-A6
  • S100 calcium binding protein A6
  • S100 calcium-binding protein A6 (calcyclin)
  • S100 calcium-binding protein A6
  • S100A6

Background

S100A6 is a member of the S100 family of proteins, and may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Recent studies have found that S100A6 is induced by tumour necrosis factor-alpha via a NF-kappaB-dependent mechanism, which serves a role in limiting tumour necrosis factor-alpha-induced apoptosis by regulating p53 phosphorylation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4277
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-87102
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-87103
Species: Hu
Applications: IHC,  IHC-P, WB
AF3366
Species: Hu
Applications: ICC, IHC, Simple Western, WB
DAN00
Species: Hu
Applications: ELISA
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP3-46899
Species: Hu
Applications: ELISA, ICC/IF, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-57362
Species: Hu
Applications: ICC/IF, WB
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC

Publications for S100A6 Antibody (NBP1-89388)(8)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 4 applications: ICC/IF, IF/IHC, Immunohistochemistry, WB.


Filter By Application
ICC/IF
(1)
IF/IHC
(1)
Immunohistochemistry
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
Mouse
(3)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-89388 Applications Species
Schartz ND, Liang HY, Carvalho K et Al. C5aR1 antagonism suppresses inflammatory glial responses and alters cellular signaling in an Alzheimer's disease mouse model Nat Commun 2024-08-15 [PMID: 39147742]
Schartz ND, Liang HY, Carvalho K et al. C5aR1 antagonism suppresses inflammatory glial gene expression and alters cellular signaling in an aggressive Alzheimer's model bioRxiv 2023-08-27 [PMID: 37662399] (Immunohistochemistry, Human, Mouse) Immunohistochemistry Human, Mouse
Derk J, Como CN, Jones HE et al. Formation and function of the meningeal arachnoid barrier around the developing mouse brain Developmental cell 2023-03-22 [PMID: 36996816]
Jones HE, Abrams KA, Siegenthaler JA Techniques for visualizing fibroblast-vessel interactions in the developing and adult CNS Neurophotonics 2022-04-01 [PMID: 35402637]
Driskill JH, Zheng Y, Wu BK et al. WWTR1(TAZ)-CAMTA1 reprograms endothelial cells to drive epithelioid hemangioendothelioma Genes & development 2021-04-01 [PMID: 33766984]
DeSisto J, O'Rourke R, Jones HE et al. Single-Cell Transcriptomic Analyses of the Developing Meninges Reveal Meningeal Fibroblast Diversity and Function Dev. Cell 2020-07-06 [PMID: 32634398]
Tian ZY, Wang CY, Wang T et al. Glial S100A6 Degrades beta-amyloid Aggregation through Targeting Competition with Zinc Ions Aging Dis 2019-08-01 [PMID: 31440382] (ICC/IF, WB, Mouse) ICC/IF, WB Mouse
Mehdi Damaghi, Narges K. Tafreshi, Mark C. Lloyd et al. Chronic acidosis in the tumour microenvironment selects for overexpression of LAMP2 in the plasma membrane. Nature Communications 2015-01-01 [PMID: 26658462] (IF/IHC, Human, Mouse) IF/IHC Human, Mouse

Reviews for S100A6 Antibody (NBP1-89388) (0)

There are no reviews for S100A6 Antibody (NBP1-89388). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for S100A6 Antibody (NBP1-89388) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional S100A6 Products

Research Areas for S100A6 Antibody (NBP1-89388)

Find related products by research area.

Blogs on S100A6.

S100A6: Playing Roles in Cancer, Apoptosis & Transcription Regulation
S100A6 antibodies detect a small calcium binding protein with 2 EF-hand structures and belongs to the S100 family. Calcium binding induces a conformational change of the protein which in turn permits its interaction with several target proteins. It is...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A6 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A6