S100A4 Antibody (1F12-1G7)

Images

 
Western Blot: S100A4 Antibody (1F12-1G7) [H00006275-M01] - S100A4 monoclonal antibody (M01), clone 1F12-1G7. Analysis of S100A4 expression in Raw 264.7.
Immunocytochemistry/ Immunofluorescence: S100A4 Antibody (1F12-1G7) [H00006275-M01] - Analysis of monoclonal antibody to S100A4 on HeLa cell. Antibody concentration 15 ug/ml.
Western Blot: S100A4 Antibody (1F12-1G7) [H00006275-M01] - S100A4 expression in NIH/3T3 ( Cat # L018V1).
Western Blot: S100A4 Antibody (1F12-1G7) [H00006275-M01] - S100A4 monoclonal antibody (M01), clone 1F12-1G7 Analysis of S100A4 expression in Hela.
Western Blot: S100A4 Antibody (1F12-1G7) [H00006275-M01] - Analysis of S100A4 expression in transfected 293T cell line by S100A4 monoclonal antibody (M01), clone 1F12-1G7.Lane 1: S100A4 transfected lysate(11.7 KDa).Lane ...read more
ELISA: S100A4 Antibody (1F12-1G7) [H00006275-M01] - Detection limit for recombinant GST tagged S100A4 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1F12-1G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

S100A4 Antibody (1F12-1G7) Summary

Immunogen
S100A4 (AAH16300, 1 a.a. - 101 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK
Specificity
S100A4 - S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
S100A4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for IF and ELISA. IHC was reported in scientific literature.
Positive Control
S100A4 Lysate (NBP2-64866)
Publications
Read Publications using
H00006275-M01 in the following applications:

  • 2 publications
  • IHC
    2 publications
  • WB
    1 publication

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for S100A4 Antibody (1F12-1G7)

  • 18A2
  • 42A
  • Calvasculin
  • CAPL
  • CAPLS100 calcium binding protein A4 (calcium protein, calvasculin, metastasin
  • fibroblast-specific protein-1,42A
  • FSP1
  • leukemia multidrug resistance associated protein
  • malignant transformation suppression 1
  • Metastasin
  • MTS1
  • murine placental homolog)
  • P9KA
  • PEL98
  • Placental calcium-binding protein
  • Protein Mts1
  • protein S100-A4
  • S100 calcium binding protein A4
  • S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)
  • S100 calcium-binding protein A4
  • S100A4

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45603
Species: Hu
Applications: WB, Flow, IHC
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-193
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF4870
Species: Hu
Applications: WB, ICC
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006275-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF

Publications for S100A4 Antibody (H00006275-M01)(13)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(2)
IHC
(2)
WB
(1)
All Applications
Filter By Species
Mouse
(2)
All Species
Showing Publications 1 - 10 of 13. Show All 13 Publications.
Publications using H00006275-M01 Applications Species
Kan C, Chen L, Hu Y et al. Gli1-labeled adult mesenchymal stem/progenitor cells and hedgehog signaling contribute to endochondral heterotopic ossification. Bone. 2017 Jun 21 [PMID: 28645539]
Cosme J, Guo H, Hadipour-Lakmehsari S et al. Hypoxia-induced changes in the fibroblast secretome, exosome, and whole-cell proteome using cultured, cardiac-derived cells isolated from neonatal mice. J Proteome Res 2017 Jun 22 [PMID: 28641008]
Lin SC, Lee YC, Yu G et al. Endothelial-to-Osteoblast Conversion Generates Osteoblastic Metastasis of Prostate Cancer. Dev Cell 2017 Jun 5 [PMID: 28586644]
Singh KK, Lovren F, Pan Y et al. The essential autophagy gene ATG7 modulates organ fibrosis via regulation of endothelial-to-mesenchymal transition. J Biol Chem 2015 Jan 30 [PMID: 25527499] (WB) WB
Volonte A, Di Tomaso T, Spinelli M et al. Cancer-Initiating Cells from Colorectal Cancer Patients Escape from T Cell-Mediated Immunosurveillance In Vitro through Membrane-Bound IL-4. J Immunol. 2013 Nov 25 [PMID: 24277698]
Birbrair A, Zhang T, Wang ZM et al. Type-1 pericytes participate in fibrous tissue deposition in aged skeletal muscle. Am J Physiol Cell Physiol 2013 Dec 1 [PMID: 24067916] (IHC, ICC/IF, Mouse) IHC, ICC/IF Mouse
Li Q, Zhang D, Wang Y et al. MiR-21/Smad 7 signaling determines TGF-b1-induced CAF formation. Sci Rep. 2013 Jan 01 [PMID: 23784029]
Kan L, Peng CY, McGuire TL, Kessler JA et al. Glast-expressing progenitor cells contribute to heterotopic ossification Bone 2012 Dec 20 [PMID: 23262027] (IHC, ICC/IF, Mouse) IHC, ICC/IF Mouse
Chen Y, Huang K, Nakatsu MN et al. Identification of novel molecular markers through transcriptomic analysis in human fetal and adult corneal endothelial cells. Hum Mol Genet. 2013 Jan 08 [PMID: 23257286]
Swift-Gallant A, Monks DA. Androgen receptor expression in satellite cells of the neonatal levator ani of the rat. Dev Neurobiol. 2012 Dec 12 [PMID: 23239638]
Show All 13 Publications.

Reviews for S100A4 Antibody (H00006275-M01) (0)

There are no reviews for S100A4 Antibody (H00006275-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for S100A4 Antibody (H00006275-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional S100A4 Products

Bioinformatics Tool for S100A4 Antibody (H00006275-M01)

Discover related pathways, diseases and genes to S100A4 Antibody (H00006275-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for S100A4 Antibody (H00006275-M01)

Discover more about diseases related to S100A4 Antibody (H00006275-M01).
 

Pathways for S100A4 Antibody (H00006275-M01)

View related products by pathway.

PTMs for S100A4 Antibody (H00006275-M01)

Learn more about PTMs related to S100A4 Antibody (H00006275-M01).
 

Research Areas for S100A4 Antibody (H00006275-M01)

Find related products by research area.

Blogs on S100A4.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our S100A4 Antibody (1F12-1G7) and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A4
Entrez
OMIM
Uniprot