RBFOX3/NeuN Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RBFOX3/NeuN Antibody [NBP1-89821] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: RBFOX3/NeuN Antibody [NBP1-89821] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBFOX3/NeuN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQ
Marker
Neuronal Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBFOX3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBFOX3/NeuN Recombinant Protein Antigen (NBP1-89821PEP)
Publications
Read Publications using NBP1-89821.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24747576)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBFOX3/NeuN Antibody

  • FLJ56884
  • FLJ58356
  • Fox-1 homolog C
  • FOX3
  • FOX-3
  • hexaribonucleotide binding protein 3
  • HRNBP3
  • NeuN
  • neuronal nuclei
  • RBFOX3
  • RNA binding protein fox-1 homolog 3
  • RNA binding protein, fox-1 homolog (C. elegans) 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF3795
Species: Hu
Applications: WB, IP
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RBFOX3/NeuN Antibody (NBP1-89821)(2)

Reviews for RBFOX3/NeuN Antibody (NBP1-89821) (0)

There are no reviews for RBFOX3/NeuN Antibody (NBP1-89821). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RBFOX3/NeuN Antibody (NBP1-89821) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBFOX3/NeuN Products

Bioinformatics Tool for RBFOX3/NeuN Antibody (NBP1-89821)

Discover related pathways, diseases and genes to RBFOX3/NeuN Antibody (NBP1-89821). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBFOX3/NeuN Antibody (NBP1-89821)

Discover more about diseases related to RBFOX3/NeuN Antibody (NBP1-89821).
 

Pathways for RBFOX3/NeuN Antibody (NBP1-89821)

View related products by pathway.

Research Areas for RBFOX3/NeuN Antibody (NBP1-89821)

Find related products by research area.

Blogs on RBFOX3/NeuN.

RBFOX3: Binding RNA, like a FOX
NeuN is a RNA-binding protein that modulates alternative splicing and is localized both to the nucleus and cytoplasm. It is a member of the RNA-binding FOX (RBFOX) family of splicing regulators which includes RBFOX1 (Fox-1/A2BP1) and RBFOX2 (Fox-2/RBM...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBFOX3/NeuN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBFOX3