Calretinin Antibody

Images

 
Genetic Strategies: Western Blot: Calretinin Antibody [NBP1-88220] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. ...read more
Immunocytochemistry/ Immunofluorescence: Calretinin Antibody [NBP1-88220] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human soft tissues.
Western Blot: Calretinin Antibody [NBP1-88220] - Analysis in human cerebral cortex tissue.
Western Blot: Calretinin Antibody [NBP1-88220] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Independent Antibodies: Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human cerebral cortex, liver, soft tissues and testis using Anti-CALB2 antibody NBP1-88220 (A) shows similar ...read more
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human liver.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Staining of human testis.
Immunohistochemistry-Paraffin: Calretinin Antibody [NBP1-88220] - Alcohol fixed, paraffin embedded rat brain tissue. Image from verified customer review.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calretinin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKY
Marker
Mesothelial Cell Marker
Specificity
Specificity of human Calretinin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Reviewed Applications
Read 1 Review rated 5
using
NBP1-88220 in the following applications:

Publications
Read Publication using NBP1-88220.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calretinin Antibody

  • 29 kDa calbindin
  • CAB29
  • CAL2
  • CALB2
  • calbindin 2
  • calbindin 2, (29kD, calretinin)
  • calbindin 2, 29kDa (calretinin)
  • calbindin D29K
  • Calretinin
  • CR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1107
Species: Mu
Applications: WB, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC-Fr, IF
NBP2-50028
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-FrFl
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-69571
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB, IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-534
Species: Hu, Mu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
AF3846
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-59370
Species: Hu, Rt, Po, Bv, Ca, Eq, GP
Applications: WB
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
NBP2-67691
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-88220
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Calretinin Antibody (NBP1-88220)(1)

Review for Calretinin Antibody (NBP1-88220) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-88220:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Calretinin NBP1-88220
Enlarge
reviewed by:
Anonymous
IHC-P Rat 01/07/2019
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedBrain tissue
SpeciesRat
LotA83215

Comments

CommentsRat brain tissue - Alcohol fixed-paraffin embedded

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calretinin Antibody (NBP1-88220) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Calretinin Products

Bioinformatics Tool for Calretinin Antibody (NBP1-88220)

Discover related pathways, diseases and genes to Calretinin Antibody (NBP1-88220). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calretinin Antibody (NBP1-88220)

Discover more about diseases related to Calretinin Antibody (NBP1-88220).
 

Pathways for Calretinin Antibody (NBP1-88220)

View related products by pathway.

PTMs for Calretinin Antibody (NBP1-88220)

Learn more about PTMs related to Calretinin Antibody (NBP1-88220).
 

Research Areas for Calretinin Antibody (NBP1-88220)

Find related products by research area.

Blogs on Calretinin.

Using RPE65 as a tool to investigate ocular gene therapies
While not life threatening, blindness and retinal disease are profoundly debilitating and greatly affect quality of life.  Understandably, gene therapy has been subject to controversy given it’s potential effects on the rest of our cellular...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
01/07/2019
Application: IHC-P
Species: Rat

Bioinformatics

Gene Symbol CALB2