Western Blot: Enolase 1 Antibody (253) [NBP2-25147] - Analysis of different cell lysates using mouse mAb to alpha-enolase, NBP2-25147, dilution 1:10,000 in green: [1] protein standard (red), [2] NIH-3T3 l, [3] C6, [4] ...read more
Immunocytochemistry/ Immunofluorescence: Enolase 1 Antibody (253) [NBP2-25147] - Analysis of HeLa cells stained with mouse mAb to alpha-enolase, NBP2-25147, dilution 1:500 in green and costained with chicken pAb to ...read more
Immunocytochemistry/ Immunofluorescence: Enolase 1 Antibody (253) [NBP2-25147] - Rat 3T3 cells stained with NBP2-25147 (green) and counterstained with chicken polyclonal antibody to Vimentin NB300-223 (red) and DNA ...read more
Simple Western: Enolase 1 Antibody (253) [NBP2-25147] - Simple Western lane view shows a specific band for Enolase 1 in 0.5 mg/mL of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 ...read more
This Enolase 1 (253) antibody is useful for Immunocytochemistry/Immunofluorescence and Western blot, where a band can be seen at approx. 47 kDa. Use in Immmunoassay reported in scientific literature (PMID: 31035430).
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in HeLa lysate 0.5 mg/mL, separated by Size, antibody dilution of 1:500, apparent MW was 51 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Theoretical MW
47 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP2-25147 in the following applications:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
50% PBS, 50% glycerol
Preservative
5mM Sodium Azide
Concentration
1 mg/ml
Purity
Protein G purified
Alternate Names for Enolase 1 Antibody (253) - BSA Free
2-phospho-D-glycerate hydro-lyase
Alpha enolase
C-myc promoter-binding protein
c-myc promoter-binding protein-1
EC 4.2.1
EC 4.2.1.11
ENO1L1
Enolase 1
enolase 1, (alpha)
MBP-1
MBPB1
MPB-1
MPB1c-myc promoter-binding protein 1
MYC promoter-binding protein 1
NNE
Non-neural enolase
Phosphopyruvate hydratase
Plasminogen-binding protein
PPHalpha enolase like 1
tau-crystallin
Background
Enolases are enzymes which catalyze the conversion of 2-phosphoglycerate to phosphoenolpyruvate in the glycolytic pathway, and also the reverse reaction in gluconeogenesis. The Enzyme Commission classification number for this class of enzyme is EC4.2.1.11, and they can also be referred to as 2-phospho-D-glycerate hydrolases. There are three enolase proteins each coded for by a distinct gene. They are known as Enolase 1, 2 and 3 or alternately as alpha, beta and gamma-Enolase. Confusingly, although Enolase 1 is alpha-Enolase, Enolase 2 corresponds to gamma-Enolase while Enolase 3 is also known as beta-Enolase. All three enzymes exist as dimers in vivo and the three molecules are very similar in primary amino acids sequence. This similarity allows not only homodimers but also most possible heterodimers to form. The expression pattern of the three enzymes differs in a tissue specific manner, so that antibodies to them are useful cell type specific markers, especially as all three molecules are very abundant. Enolase 1 or alpha is also known as non-neuronal Enolase (NNE) and is expressed in most kinds of tissue, but is absent from neurons. Abnormal expression of NNE is associated with tumor progression in some breast and head and neck cancer. Enolase 2 or gamma is also known as neuron specific enolase (NSE). A switch from NNE to NSE occurs in the development of neurons. Enolase 3 or beta is expressed primarily in muscle cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for Enolase 1 Antibody (NBP2-25147). (Showing 1 - 1 of 1 FAQs).
Enolase came up as a candidate in mass spec. There are at least three isoforms which showed up once or twice or three times (as in three mass spec repeats). To validate the mass data, we are looking into quantitate each isoform. Which antibodies are specific for each of the three?
We checked all antibodies to Enolase 1, Enolase 2 and Enolase 3, but unfortunately no cross reactivity testing was performed for any of these antibodies. Considering how similar these proteins are, it is reasonable to expect some of them will react with other enolases. Base on immunogen sequence, we found some that were raised to the most diverse regions between these proteins, so it is possible that these will be the most specific to the protein they were raised to.For Enolase 1, your best bet is NBP2-25147 as it was raised to N terminal peptide of bovine Eno1: MSILKVHAREIFFor Enolase 2, I found 3 candidate antibodies:NBP2-53158 and NBP2-50532 were raised to aa416-433 (ELGDEARFAGHNFRNPSVL) - it says these antibodies are only reactive with human but they will also work for mouse since the immunogen is 100% matchNBP2-50533, which was raised to aa271-285 (GDQLGALYQDFVRD) - which is also likely to react with mouse, the immunogen is 93% match with mouse (only last aminoacid is different)For Enolase 3, your best bet would be H00002027-M01 or H00002027-A01. both were raised to aa228-277 (KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG) - 98% match to mouseThe immunogens for all these antibodies fall into most variable regions, however, since we have not performed crossreactivity testing, we can not guarantee that they will not crossreact to some extent.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Enolase 1 Antibody (253) - BSA Free and receive a gift card or discount.