Enolase 1 Antibody (253) - BSA Free

Images

 
Western Blot: Enolase 1 Antibody (253) [NBP2-25147] - Analysis of different cell lysates using mouse mAb to alpha-enolase, NBP2-25147, dilution 1:10,000 in green: [1] protein standard (red), [2] NIH-3T3 l, [3] C6, [4] ...read more
Immunocytochemistry/ Immunofluorescence: Enolase 1 Antibody (253) [NBP2-25147] - Analysis of HeLa cells stained with mouse mAb to alpha-enolase, NBP2-25147, dilution 1:500 in green and costained with chicken pAb to ...read more
Immunocytochemistry/ Immunofluorescence: Enolase 1 Antibody (253) [NBP2-25147] - Rat 3T3 cells stained with NBP2-25147 (green) and counterstained with chicken polyclonal antibody to Vimentin NB300-223 (red) and DNA ...read more
Simple Western: Enolase 1 Antibody (253) [NBP2-25147] - Simple Western lane view shows a specific band for Enolase 1 in 0.5 mg/mL of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, EqSpecies Glossary
Applications WB, Simple Western, ELISA, ICC/IF, IHC
Clone
253
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Format
BSA Free
Concentration
1 mg/ml

Order Details

Enolase 1 Antibody (253) - BSA Free Summary

Immunogen
The N-terminal 12 amino acids of bovine Enolase 1, which was synthesized on a 8-amine lysine core. [UniProt# Q9XSJ4]
Localization
Cytoplasm. Cell membrane. Cytoplasm > myofibril > sarcomere > M line.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ENO1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunoassay
  • Immunocytochemistry/ Immunofluorescence 1:2000 - 1:5000
  • Immunohistochemistry 1:2000 - 1:5000
  • Simple Western 1:500
  • Western Blot 1:5000 - 1:10000
Application Notes
This Enolase 1 (253) antibody is useful for Immunocytochemistry/Immunofluorescence and Western blot, where a band can be seen at approx. 47 kDa. Use in Immmunoassay reported in scientific literature (PMID: 31035430).

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in HeLa lysate 0.5 mg/mL, separated by Size, antibody dilution of 1:500, apparent MW was 51 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP2-25147 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
50% PBS, 50% glycerol
Preservative
5mM Sodium Azide
Concentration
1 mg/ml
Purity
Protein G purified

Alternate Names for Enolase 1 Antibody (253) - BSA Free

  • 2-phospho-D-glycerate hydro-lyase
  • Alpha enolase
  • C-myc promoter-binding protein
  • c-myc promoter-binding protein-1
  • EC 4.2.1
  • EC 4.2.1.11
  • ENO1L1
  • Enolase 1
  • enolase 1, (alpha)
  • MBP-1
  • MBPB1
  • MPB-1
  • MPB1c-myc promoter-binding protein 1
  • MYC promoter-binding protein 1
  • NNE
  • Non-neural enolase
  • Phosphopyruvate hydratase
  • Plasminogen-binding protein
  • PPHalpha enolase like 1
  • tau-crystallin

Background

Enolases are enzymes which catalyze the conversion of 2-phosphoglycerate to phosphoenolpyruvate in the glycolytic pathway, and also the reverse reaction in gluconeogenesis. The Enzyme Commission classification number for this class of enzyme is EC4.2.1.11, and they can also be referred to as 2-phospho-D-glycerate hydrolases. There are three enolase proteins each coded for by a distinct gene. They are known as Enolase 1, 2 and 3 or alternately as alpha, beta and gamma-Enolase. Confusingly, although Enolase 1 is alpha-Enolase, Enolase 2 corresponds to gamma-Enolase while Enolase 3 is also known as beta-Enolase. All three enzymes exist as dimers in vivo and the three molecules are very similar in primary amino acids sequence. This similarity allows not only homodimers but also most possible heterodimers to form. The expression pattern of the three enzymes differs in a tissue specific manner, so that antibodies to them are useful cell type specific markers, especially as all three molecules are very abundant. Enolase 1 or alpha is also known as non-neuronal Enolase (NNE) and is expressed in most kinds of tissue, but is absent from neurons. Abnormal expression of NNE is associated with tumor progression in some breast and head and neck cancer. Enolase 2 or gamma is also known as neuron specific enolase (NSE). A switch from NNE to NSE occurs in the development of neurons. Enolase 3 or beta is expressed primarily in muscle cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-67503
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF226
Species: Hu
Applications: WB
7954-GM/CF
Species: Hu
Applications: BA
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB41281
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
AF4478
Species: Hu
Applications: IHC, WB
NBP3-41306
Species: Hu, Mu, Rt
Applications: WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
NBP3-03282
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF3844
Species: Hu, Mu
Applications: IHC
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-25147
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ELISA, ICC/IF, IHC

Publications for Enolase 1 Antibody (NBP2-25147)(3)

Reviews for Enolase 1 Antibody (NBP2-25147) (0)

There are no reviews for Enolase 1 Antibody (NBP2-25147). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Enolase 1 Antibody (NBP2-25147). (Showing 1 - 1 of 1 FAQs).

  1. Enolase came up as a candidate in mass spec. There are at least three isoforms which showed up once or twice or three times (as in three mass spec repeats). To validate the mass data, we are looking into quantitate each isoform. Which antibodies are specific for each of the three?
    • We checked all antibodies to Enolase 1, Enolase 2 and Enolase 3, but unfortunately no cross reactivity testing was performed for any of these antibodies. Considering how similar these proteins are, it is reasonable to expect some of them will react with other enolases. Base on immunogen sequence, we found some that were raised to the most diverse regions between these proteins, so it is possible that these will be the most  specific to the protein they were raised to.For Enolase 1, your best bet is NBP2-25147  as it was raised to N terminal peptide of bovine Eno1: MSILKVHAREIFFor Enolase 2, I found 3 candidate antibodies:NBP2-53158  and NBP2-50532  were raised to aa416-433 (ELGDEARFAGHNFRNPSVL) - it says these antibodies are only reactive with human but they will also work for mouse since the immunogen is 100% matchNBP2-50533, which was raised to aa271-285 (GDQLGALYQDFVRD) - which is also likely to react with mouse, the immunogen is 93% match with mouse (only last aminoacid is different)For Enolase 3, your best bet would be H00002027-M01 or H00002027-A01. both were raised to aa228-277 (KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG) - 98% match to mouseThe immunogens for all these antibodies fall into most variable regions, however, since we have not performed crossreactivity testing, we can not guarantee that they will not crossreact to some extent.

Secondary Antibodies

 

Isotype Controls

Additional Enolase 1 Products

Research Areas for Enolase 1 Antibody (NBP2-25147)

Find related products by research area.

Blogs on Enolase 1

There are no specific blogs for Enolase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Enolase 1 Antibody (253) - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ENO1
Entrez
OMIM
Uniprot