Rad17 Antibody

Images

 
Western Blot: Rad17 Antibody [NBP1-86561] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: Rad17 Antibody [NBP1-86561] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Rad17 Antibody [NBP1-86561] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Rad17 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVFKEFLLRATKYNKLQMLGDDLRTDKKIILVEDLPNQFYRDSHTLHEVLRKYVRIGRCPLIFIISDSLSGDNNQRLLFPKEIQEECSISNISFNPVAP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAD17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Rad17 Protein (NBP1-86561PEP)
Publications
Read Publications using NBP1-86561.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Rad17 Antibody

  • CCYC
  • cell cycle checkpoint protein (RAD17)
  • cell cycle checkpoint protein RAD17
  • FLJ41520
  • HRAD17
  • R24L
  • RAD1 (S. pombe) homolog
  • RAD1 homolog
  • RAD17 homolog (S. pombe)
  • Rad17
  • Rad17-like protein
  • RAD17SP
  • RAD24
  • RF-C activator 1 homolog
  • RF-C/activator 1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56320
Species: Hu
Applications: WB
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89445
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NB100-247
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-03346
Species: Hu
Applications: WB, IHC-P, IP, PLA

Publications for Rad17 Antibody (NBP1-86561)(2)

Reviews for Rad17 Antibody (NBP1-86561) (0)

There are no reviews for Rad17 Antibody (NBP1-86561). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Rad17 Antibody (NBP1-86561) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Rad17 Products

Bioinformatics Tool for Rad17 Antibody (NBP1-86561)

Discover related pathways, diseases and genes to Rad17 Antibody (NBP1-86561). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Rad17 Antibody (NBP1-86561)

Discover more about diseases related to Rad17 Antibody (NBP1-86561).
 

Pathways for Rad17 Antibody (NBP1-86561)

View related products by pathway.

PTMs for Rad17 Antibody (NBP1-86561)

Learn more about PTMs related to Rad17 Antibody (NBP1-86561).

Blogs on Rad17

There are no specific blogs for Rad17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Rad17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD17
Entrez