Rad17 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Rad17 Antibody [NBP1-86561] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: Rad17 Antibody [NBP1-86561] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Analysis in control (vector only transfected HEK293T lysate) and RAD17 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Rad17 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Rad17 Antibody - BSA Free (NBP1-86561) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Rad17 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVFKEFLLRATKYNKLQMLGDDLRTDKKIILVEDLPNQFYRDSHTLHEVLRKYVRIGRCPLIFIISDSLSGDNNQRLLFPKEIQEECSISNISFNPVAP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RAD17
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization, Use PFA/Triton X-100.
• Control Peptide:

  Rad17 Protein (NBP1-86561PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Rad17 Antibody - BSA Free

• CCYC
• cell cycle checkpoint protein (RAD17)
• cell cycle checkpoint protein RAD17
• FLJ41520
• HRAD17
• R24L
• RAD1 (S. pombe) homolog
• RAD1 homolog
• RAD17 homolog (S. pombe)
• Rad17
• Rad17-like protein
• RAD17SP
• RAD24
• RF-C activator 1 homolog
• RF-C/activator 1 homolog

Background

Signals originating from damaged DNA activate checkpoint pathways and target the mitotic apparatus via a number a distinct mechanisms. These checkpoints link damage to DNA with the components of the cell cycle through signal transduction systems. In mammals, five genes have been identified as components of DNA damage-induced checkpoint pathways: ATM, p53, p21/WAF1/CIP1, hCHK1, and 14-3-3sigma. When overexpressed in mammalian cells, hRAD17 activates p53 and causes an accumulation of G1 phase cells, suggesting an involvement of the hRAD17 gene in this checkpoint pathway.(1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Rad17 Antibody (NBP1-86561)(2)

Publications using NBP1-86561

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]
• Kato BS, Nicholson G, Neiman M et al. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Sci 2011-11-17 [PMID: 22093360]

Bioinformatics

• Gene Symbol: RAD17