Reduced Folate Carrier/SLC19A1 Antibody

Western Blot: Reduced Folate Carrier/SLC19A1 Antibody [NBP1-59904] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.

Immunohistochemistry-Paraffin: Reduced Folate Carrier/SLC19A1 Antibody [NBP1-59904] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Reduced Folate Carrier/SLC19A1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to SLC19A1(solute carrier family 19 (folate transporter), member 1) The peptide sequence was selected from the N terminal of SLC19A1. Peptide sequence MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC19A1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
• Application Notes: This is a rabbit polyclonal antibody against SLC19A1 and was validated on Western Blot and immunohistochemistry-paraffin
• Control:

  Reduced Folate Carrier/SLC19A1 Knockout 293T Cell Lysate

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Reduced Folate Carrier/SLC19A1 Antibody

• CHMD
• FLOT1
• folate transporter 1
• FOLT
• FOLThuman reduced folate carrier (RFC)10Intestinal folate carrier 1
• IFC1
• IFC-1
• Placental folate transporter
• Reduced folate carrier protein
• REFC
• RFC
• RFC1
• SLC19A1
• solute carrier family 19 (folate transporter), member 1
• Solute carrier family 19 member 1

Background

Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC19A1
• Uniprot:
  • P41440()