Reduced Folate Carrier/SLC19A1 Antibody Summary
Immunogen |
Synthetic peptides corresponding to SLC19A1(solute carrier family 19 (folate transporter), member 1) The peptide sequence was selected from the N terminal of SLC19A1.
Peptide sequence MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SLC19A1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:100-1:2000
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
|
Application Notes |
This is a rabbit polyclonal antibody against SLC19A1 and was validated on Western Blot and immunohistochemistry-paraffin |
Control |
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Protein A purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Reduced Folate Carrier/SLC19A1 Antibody
Background
Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM].
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: DB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, MiAr
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, KO, ELISA(Sta)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Publications for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904) (0)
There are no publications for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904) (0)
There are no reviews for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904) (0)
Control Lysate(s)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional Reduced Folate Carrier/SLC19A1 Products
Bioinformatics Tool for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904)
Discover related pathways, diseases and genes to Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904)
Discover more about diseases related to Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904).
| | Pathways for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904)
View related products by pathway.
|
PTMs for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904)
Learn more about PTMs related to Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904).
|
Blogs on Reduced Folate Carrier/SLC19A1