Reduced Folate Carrier/SLC19A1 Antibody

Images

 
Western Blot: Reduced Folate Carrier/SLC19A1 Antibody [NBP1-59904] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.
Immunohistochemistry-Paraffin: Reduced Folate Carrier/SLC19A1 Antibody [NBP1-59904] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Reduced Folate Carrier/SLC19A1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC19A1(solute carrier family 19 (folate transporter), member 1) The peptide sequence was selected from the N terminal of SLC19A1. Peptide sequence MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC19A1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SLC19A1 and was validated on Western Blot and immunohistochemistry-paraffin
Control
Reduced Folate Carrier/SLC19A1 Knockout 293T Cell Lysate

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Reduced Folate Carrier/SLC19A1 Antibody

  • CHMD
  • FLOT1
  • folate transporter 1
  • FOLT
  • FOLThuman reduced folate carrier (RFC)10Intestinal folate carrier 1
  • IFC1
  • IFC-1
  • Placental folate transporter
  • Reduced folate carrier protein
  • REFC
  • RFC
  • RFC1
  • SLC19A1
  • solute carrier family 19 (folate transporter), member 1
  • Solute carrier family 19 member 1

Background

Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF3989
Species: Hu, Mu, Rt
Applications: WB
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
H00010560-Q01
Species: Hu
NBP1-87741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06603
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NB100-791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-57749
Species: Hu
Applications: WB, IHC
NBP1-22439
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-61727
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-84941
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-45210
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, KO, ELISA(Sta)
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP2-67563
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
H00004143-M01
Species: Hu, Ce
Applications: WB, ELISA, IP, S-ELISA

Publications for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904) (0)

There are no publications for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904) (0)

There are no reviews for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Reduced Folate Carrier/SLC19A1 Products

Bioinformatics Tool for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904)

Discover related pathways, diseases and genes to Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904)

Discover more about diseases related to Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904).
 

Pathways for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904)

View related products by pathway.

PTMs for Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904)

Learn more about PTMs related to Reduced Folate Carrier/SLC19A1 Antibody (NBP1-59904).

Blogs on Reduced Folate Carrier/SLC19A1

There are no specific blogs for Reduced Folate Carrier/SLC19A1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Reduced Folate Carrier/SLC19A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC19A1
Uniprot