HUS1 Antibody - BSA Free

Western Blot: HUS1 Antibody [NBP1-89445] - Image was provided by Dr. A-Lien Lu-Chang at Department of Biochemistry & Molecular Biology, University of Maryland School of Medicine.

Staining of human cervix, uterine moderate nuclear positivity in squamous epithelial cells.

Staining of human rectum shows moderate nuclear positivity in glandular cells.

Staining of human prostate shows moderate nuclear positivity in glandular cells.

Staining of human testis shows strong nuclear positivity in subset of cells in seminiferous ducts.

Analysis in control (vector only transfected HEK293T lysate) and HUS1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HUS1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQENFFNEFQMEGVSAENNEIYLELTSENLSRASKTAQNARALKIKLTNKHFPCLTVSVELLSMSSSSRIVTHD
• Predicted Species: Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HUS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID:32991318).
• Control Peptide:

  HUS1 Protein (NBP1-89445PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HUS1 Antibody - BSA Free

• checkpoint protein HUS1
• hHUS1
• HUS1 (S. pombe) checkpoint homolog
• HUS1 checkpoint homolog (S. pombe)
• hus1+-like protein

Background

The protein encoded by the HUS1 gene is a component of an evolutionarily conserved, genotoxin-activated checkpoint complex that is involved in the cell cycle arrest in response to DNA damage. This protein forms a heterotrimeric complex with checkpoint proteins RAD9 and RAD1. In response to DNA damage, the trimeric complex interacts with another protein complex consisting of checkpoint protein RAD17 and four small subunits of the replication factor C (RFC), which loads the combined complex onto the chromatin. The DNA damage induced chromatin binding has been shown to depend on the activation of the checkpoint kinase ATM, and is thought to be an early checkpoint signaling event.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HUS1 Antibody (NBP1-89445)(1)

Publication using NBP1-89445

• Tan J, Wang X, Hwang BJ et al. An ordered assembly of MYH glycosylase, SIRT6 protein deacetylase, and Rad9-Rad1-Hus1 checkpoint clamp at oxidatively damaged telomeres Aging (Albany NY) 2020-09-29 [PMID: 32991318] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: HUS1