RRAD Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RRAD Antibody [NBP2-13266] - Staining of human cell line A549 shows localization to nucleoplasm, plasma membrane & the Golgi apparatus.
Immunohistochemistry: RRAD Antibody [NBP2-13266] - Staining of human heart muscle shows moderate membranous positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RRAD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGG RWLPGHCMAMGDAYVIVYSVTDK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RRAD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RRAD Protein (NBP2-13266PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RRAD Antibody

  • RAD1
  • RADGTP-binding protein RAD
  • RAS (RAD and GEM) like GTP binding 3
  • Ras associated with diabetes
  • Ras-related associated with diabetes
  • REM3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89445
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58116
Species: Hu
Applications: ICC/IF
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
H00028954-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00161253-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for RRAD Antibody (NBP2-13266) (0)

There are no publications for RRAD Antibody (NBP2-13266).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RRAD Antibody (NBP2-13266) (0)

There are no reviews for RRAD Antibody (NBP2-13266). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RRAD Antibody (NBP2-13266) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RRAD Products

Bioinformatics Tool for RRAD Antibody (NBP2-13266)

Discover related pathways, diseases and genes to RRAD Antibody (NBP2-13266). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RRAD Antibody (NBP2-13266)

Discover more about diseases related to RRAD Antibody (NBP2-13266).
 

Pathways for RRAD Antibody (NBP2-13266)

View related products by pathway.

PTMs for RRAD Antibody (NBP2-13266)

Learn more about PTMs related to RRAD Antibody (NBP2-13266).
 

Research Areas for RRAD Antibody (NBP2-13266)

Find related products by research area.

Blogs on RRAD

There are no specific blogs for RRAD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RRAD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RRAD