PSRC1 Antibody [Allophycocyanin] Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-215 of human PSRC1 (NP_001005290.1).
Sequence: MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLEEILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPSPSSLTPRLRSNDRKGSVRALRATSGKRPSNMKRESPTCNLFPASKSPASSPLTRSTPPVRGRAGPSGRAAASEET |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PSRC1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
PBS |
Preservative |
0.05% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for PSRC1 Antibody [Allophycocyanin]
Background
PSRC1 (proline/serine-rich coiled-coil) plays a role in regulating spindle dynamics and chromosome movement in mitosis. PSRC1 may also be involved in TP53-mediated growth suppression and CENPE gliding function. PSRC1 is known to have interactions with SRGN, AURKA, BIRC5, CALM1 and KIF11.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu
Applications: Block, IHC, Simple Western, WB
Species: Hu, Ma, Mu, Po, Rt
Applications: ICC/IF, IP, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PAGE, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: WB, ELISA
Publications for PSRC1 Antibody (NBP3-37969APC) (0)
There are no publications for PSRC1 Antibody (NBP3-37969APC).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PSRC1 Antibody (NBP3-37969APC) (0)
There are no reviews for PSRC1 Antibody (NBP3-37969APC).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PSRC1 Antibody (NBP3-37969APC) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PSRC1 Products
Blogs on PSRC1