KIF2C Antibody (1G2) - Azide and BSA Free

Western Blot: KIF2C Antibody (1G2) [H00011004-M01] - KIF2C monoclonal antibody (M01), clone 1G2 Analysis of KIF2C expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: KIF2C Antibody (1G2) [H00011004-M01] - Analysis of monoclonal antibody to KIF2C on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: KIF2C Antibody (1G2) [H00011004-M01] - Analysis of monoclonal antibody to KIF2C on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. Antibody concentration 3 ug/ml.

Western Blot: KIF2C Antibody (1G2) [H00011004-M01] - Analysis of KIF2C over-expressed 293 cell line, cotransfected with KIF2C Validated Chimera RNAi ( Cat # H00011004-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KIF2C monoclonal antibody (M01), clone 1G2 (Cat # H00011004-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: KIF2C Antibody (1G2) [H00011004-M01] - Analysis of KIF2C expression in transfected 293T cell line by KIF2C monoclonal antibody (M01), clone 1G2.Lane 1: KIF2C transfected lysate(81.3 KDa).Lane 2: Non-transfected lysate.

Immunoprecipitation: KIF2C Antibody (1G2) [H00011004-M01] - Analysis of KIF2C transfected lysate using anti-KIF2C monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KIF2C MaxPab rabbit polyclonal antibody.

Sandwich ELISA: KIF2C Antibody (1G2) [H00011004-M01] - Detection limit for recombinant GST tagged KIF2C is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC, IP, KD
• Clone: 1G2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

KIF2C Antibody (1G2) - Azide and BSA Free Summary

• Immunogen: KIF2C (AAH14924, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKI
• Localization: Cytoplasmic and Nuclear: Present throughout the cell cycle, associates with centromeres at early prophase, and remains associated with the centromere until after telophase.
• Specificity: KIF2C - kinesin family member 2C
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: KIF2C
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Knockdown Validated
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), RNAi validation and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for KIF2C Antibody (1G2) - Azide and BSA Free

• kinesin family member 2C
• kinesin-like 6 (mitotic centromere-associated kinesin)
• Kinesin-like protein 6
• kinesin-like protein KIF2C
• MCAKKNSL6kinesin-like 6
• Mitotic centromere-associated kinesin

Background

The protein encoded by this gene is a member of kinesin-like protein family. Proteins of this family are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein is important for anaphase chromosome segregation and may be required to coordinate the onset of sister centromere separation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KIF2C Antibody (H00011004-M01)(4)

Publications using H00011004-M01

• Liao S, Rajendraprasad G, Wang N et al. Molecular basis of vasohibins-mediated detyrosination and its impact on spindle function and mitosis. Cell Res. 2019-06-06 [PMID: 31171830]
• Targa B, Klipfel L, Cantaloube I et al. Septin filament coalignment with microtubules depends on SEPT9_i1 and tubulin polyglutamylation, and is an early feature of acquired cell resistance to paclitaxel. Cell Death Dis. 2019-01-22 [PMID: 30670682]
• Lancaster OM, Le Berre M, Dimitracopoulos A et al. Mitotic Rounding Alters Cell Geometry to Ensure Efficient Bipolar Spindle Formation. Dev Cell. 2013-04-25 [PMID: 23623611]
• Sanhaji M, Friel CT, Kreis NN et al. Functional and spatial regulation of mitotic centromere-associated kinesin by cyclin-dependent kinase 1. Mol Cell Biol 30(11):2594-607. 2010-06-01 [PMID: 20368358]

Bioinformatics

• Gene Symbol: KIF2C
• Entrez:
  • 11004(Human)
• OMIM:
  • 604538(Human)
• Uniprot:
  • AAH14924(Human)