PSRC1 Antibody - BSA Free

Western Blot: PSRC1 Antibody [NBP3-37969] - Western blot analysis of various lysates using PSRC1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PSRC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PSRC1 Antibody - BSA Free (NBP3-37969) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-215 of human PSRC1 (NP_001005290.1).
  
  Sequence:
  MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLEEILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPSPSSLTPRLRSNDRKGSVRALRATSGKRPSNMKRESPTCNLFPASKSPASSPLTRSTPPVRGRAGPSGRAAASEET
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSRC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 39 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PSRC1 Antibody - BSA Free

• DDA3FP3214
• differential display and activated by p53
• MGC1780
• p53-regulated DDA3
• proline/serine-rich coiled-coil 1
• proline/serine-rich coiled-coil protein 1

Background

PSRC1 (proline/serine-rich coiled-coil) plays a role in regulating spindle dynamics and chromosome movement in mitosis. PSRC1 may also be involved in TP53-mediated growth suppression and CENPE gliding function. PSRC1 is known to have interactions with SRGN, AURKA, BIRC5, CALM1 and KIF11.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSRC1