53BP2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: 53BP2 Antibody [NBP1-90324] - Staining of human cell line A-431 shows localization to cytosol & cell junctions.
Immunohistochemistry: 53BP2 Antibody [NBP1-90324] - Staining of human testis shows strong nuclear positivity in cells of the seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

53BP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TP53BP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
53BP2 Protein (NBP1-90324PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 53BP2 Antibody

  • apoptosis-stimulating protein of p53, 2
  • ASPP2P53BP2,53BP2apoptosis-stimulating of p53 protein 2
  • Bbp
  • Bcl2-binding protein
  • p53-binding protein 2
  • p53BP2
  • PPP1R13A
  • Renal carcinoma antigen NY-REN-51
  • tumor protein p53 binding protein, 2
  • tumor protein p53-binding protein, 2
  • Tumor suppressor p53-binding protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP1-90078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-48732
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
H00051426-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for 53BP2 Antibody (NBP1-90324) (0)

There are no publications for 53BP2 Antibody (NBP1-90324).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 53BP2 Antibody (NBP1-90324) (0)

There are no reviews for 53BP2 Antibody (NBP1-90324). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for 53BP2 Antibody (NBP1-90324) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 53BP2 Products

Bioinformatics Tool for 53BP2 Antibody (NBP1-90324)

Discover related pathways, diseases and genes to 53BP2 Antibody (NBP1-90324). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 53BP2 Antibody (NBP1-90324)

Discover more about diseases related to 53BP2 Antibody (NBP1-90324).
 

Pathways for 53BP2 Antibody (NBP1-90324)

View related products by pathway.

PTMs for 53BP2 Antibody (NBP1-90324)

Learn more about PTMs related to 53BP2 Antibody (NBP1-90324).
 

Research Areas for 53BP2 Antibody (NBP1-90324)

Find related products by research area.

Blogs on 53BP2

There are no specific blogs for 53BP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 53BP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TP53BP2