MCAT Antibody

Images

 
Western Blot: MCAT Antibody [NBP1-83936] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MCAT Antibody [NBP1-83936] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MCAT Protein (NBP1-83936PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCAT Antibody

  • EC 2.3.1.39
  • fabD
  • FASN2C
  • malonyl CoA:ACP acyltransferase (mitochondrial)
  • malonyl-CoA:acyl carrier protein transacylase, mitochondrial
  • malonyl-CoA-acyl carrier protein transacylase, mitochondrial
  • MCT[Acyl-carrier-protein] malonyltransferase
  • Mitochondrial malonyltransferase
  • MTMGC47838
  • NET62

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00004502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-50509
Species: Hu
Applications: IHC, IP
NBP1-89772
Species: Hu
Applications: IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-32539
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4099
Species: Hu
Applications: WB, IP
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP2-03626
Species: Hu
Applications: WB, IHC, IHC-P
AF5066
Species: Hu
Applications: WB
NBP1-82617
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-33860
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13315
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MCAT Antibody (NBP1-83936) (0)

There are no publications for MCAT Antibody (NBP1-83936).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCAT Antibody (NBP1-83936) (0)

There are no reviews for MCAT Antibody (NBP1-83936). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCAT Antibody (NBP1-83936) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCAT Products

Bioinformatics Tool for MCAT Antibody (NBP1-83936)

Discover related pathways, diseases and genes to MCAT Antibody (NBP1-83936). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCAT Antibody (NBP1-83936)

Discover more about diseases related to MCAT Antibody (NBP1-83936).
 

Pathways for MCAT Antibody (NBP1-83936)

View related products by pathway.

PTMs for MCAT Antibody (NBP1-83936)

Learn more about PTMs related to MCAT Antibody (NBP1-83936).

Blogs on MCAT

There are no specific blogs for MCAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MCAT