CELSR2 Antibody - BSA Free

Immunohistochemistry-Paraffin: CELSR2 Antibody [NLS1943] - Anti-CELSR2 antibody IHC of human Breast, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.

Immunohistochemistry-Paraffin: CELSR2 Antibody [NLS1943] - Analysis of anti-CELSR2 antibody with human, colon, epithelium.

Immunohistochemistry-Paraffin: CELSR2 Antibody [NLS1943] - Analysis of anti-CELSR2 antibody with human brain, cortex, neurons at dilution 7 ug/ml.

• Reactivity: Hu, Mu, Rt, Bv, Ca, Eq, Ha, Pm, Pm, Rb, Ma-Op
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1.0 mg/ml

CELSR2 Antibody - BSA Free Summary

• Description: Product can be stored undiluted at 4C for up to 1 month.
• Immunogen: Synthetic 18 amino acid peptide from C-terminus of human CELSR2.
• Epitope: C-Terminus
• Localization: Integral membrane protein
• Specificity: Human CELSR2. BLAST analysis of the peptide immunogen showed no homology with other human proteins.
• Predicted Species: Opossum (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CELSR2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 7 ug/ml
• Application Notes: Use in Immunohistochemistry reported in scientific literature (PMID: 22817897)..

Reactivity Notes

Predicted cross-reactivity based on sequence identity: Gibbon (100%), Marmoset (100%).

Packaging, Storage & Formulations

• Storage: Keep as concentrated solution. Aliquot and store at -20C or below. Avoid multiple freeze-thaw cycles.
• Buffer: PBS
• Preservative: 0.1% Sodium Azide
• Concentration: 1.0 mg/ml
• Purity: Immunogen affinity purified

Alternate Names for CELSR2 Antibody - BSA Free

• cadherin EGF LAG seven-pass G-type receptor 2
• Cadherin family member 10
• cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila)
• CDHF10
• CDHF10FLJ34118
• CELSR2
• EGFL2
• EGFL2FLJ45143
• EGF-like protein 2
• EGF-like-domain, multiple 2
• epidermal growth factor-like 2
• Epidermal growth factor-like protein 2
• Flamingo homolog 3
• Flamingo1
• FLJ45845
• KIAA0279FLJ42737
• MEGF3
• MEGF3cadherin, EGF LAG seven-pass G-type receptor 2, flamingo (Drosophila) homolog
• Multiple EGF-like domains protein 3
• multiple epidermal growth factor-like domains 3
• Multiple epidermal growth factor-like domains protein 3

Background

CELSR2 is an Orphan-U GPCR with an unknown ligand. CELSR2 expression has been documented in the developing mouse embryo. ESTs have been isolated from adrenal, B-cell/lung/testis, brain, breast, colon, embryo, heart, heart/melanocyte/uterus, kidney, nerve, skin, testis, and vessel libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CELSR2 Antibody (NLS1943)(1)

Publication using NLS1943

• Sugimura R, He XC, Venkatraman A et al. Noncanonical Wnt Signaling Maintains Hematopoietic Stem Cells in the Niche Cell 2012-07-20 [PMID: 22817897] (IF/IHC, Mouse)

FAQs for CELSR2 Antibody (NLS1943). (Showing 1 - 1 of 1 FAQ).

1. Can I please know the immunogenic sequences on this antibody ? I know its on the N-Terminal but I need to know the exact immunogenic sequences please. Further more, I am looking for the blocking peptide of this antibody, do you have any? Thank you
   • H00001952-Q01 is actually a partial recombinant protein whose sequence is as follows: SPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS. We do have three antibodies for this target, catalog numbers NLS1942, NLS1943 and NBP1-85712, which can be viewed on our website. The immunizing sequences for these antibodies are proprietary and cannot be disclosed. If there is a specific region that you are interested in, I would be happy to see whether these antibodies will target that area or not.

Bioinformatics

• Gene Symbol: CELSR2
• Entrez:
  • 1952(Human)
  • 53883(Mouse)
  • 83465(Rat)
• Uniprot:
  • Q9HCU4(Human)