CELSR2 Antibody

Images

 
Immunohistochemistry-Paraffin: CELSR2 Antibody [NLS1943] - Anti-CELSR2 antibody IHC of human Breast, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: CELSR2 Antibody [NLS1943] - Analysis of anti-CELSR2 antibody with human, colon, epithelium.
Immunohistochemistry-Paraffin: CELSR2 Antibody [NLS1943] - Analysis of anti-CELSR2 antibody with human brain, cortex, neurons at dilution 7 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Ha, Mk, Pm, Rb, OpSpecies Glossary
Applications IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
1.0 mg/ml

Order Details

CELSR2 Antibody Summary

Immunogen
Synthetic 18 amino acid peptide from C-terminus of human CELSR2 / EGFL2.
Localization
Integral membrane protein
Specificity
Human CELSR2 / EGFL2. BLAST analysis of the peptide immunogen showed no homology with other human proteins.
Predicted Species
Opossum (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CELSR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry-Paraffin 7 ug/ml
Publications
Read Publication using
NLS1943 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Gibbon, Marmoset. Predicted cross-reactivity based on sequence identity: Elephnat (100%), Panda (100%), Lizard (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS
Preservative
0.1% Sodium Azide
Concentration
1.0 mg/ml
Purity
Immunogen affinity purified

Alternate Names for CELSR2 Antibody

  • cadherin EGF LAG seven-pass G-type receptor 2
  • Cadherin family member 10
  • cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila)
  • CDHF10
  • CDHF10FLJ34118
  • CELSR2
  • EGFL2
  • EGFL2FLJ45143
  • EGF-like protein 2
  • EGF-like-domain, multiple 2
  • epidermal growth factor-like 2
  • Epidermal growth factor-like protein 2
  • Flamingo homolog 3
  • Flamingo1
  • FLJ45845
  • KIAA0279FLJ42737
  • MEGF3
  • MEGF3cadherin, EGF LAG seven-pass G-type receptor 2, flamingo (Drosophila) homolog
  • Multiple EGF-like domains protein 3
  • multiple epidermal growth factor-like domains 3
  • Multiple epidermal growth factor-like domains protein 3

Background

CELSR2 is an Orphan-U GPCR with an unknown ligand. CELSR2 expression has been documented in the developing mouse embryo. ESTs have been isolated from adrenal, B-cell/lung/testis, brain, breast, colon, embryo, heart, heart/melanocyte/uterus, kidney, nerve, skin, testis, and vessel libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7278
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-43790
Species: Hu
Applications: WB
NBP2-49512
Species: Hu
Applications: IHC
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
MAB1001
Species: Hu, Mu
Applications: Flow, IHC, CyTOF-ready
NBP1-83967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7475
Species: Hu, Rt
Applications: WB
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
AF6278
Species: Hu, Mu
Applications: WB
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
AF7164
Species: Hu
Applications: WB
NB200-527
Species: Hu, Mu
Applications: WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-86990
Species: Hu
Applications: WB, IHC, IHC-P
NLS1943
Species: Hu, Mu, Rt, Bv, Ca, Eq, Ha, Mk, Pm, Rb, Op
Applications: IHC-P

Publications for CELSR2 Antibody (NLS1943)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for CELSR2 Antibody (NLS1943) (0)

There are no reviews for CELSR2 Antibody (NLS1943). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CELSR2 Antibody (NLS1943). (Showing 1 - 1 of 1 FAQ).

  1. Can I please know the immunogenic sequences on this antibody ? I know its on the N-Terminal but I need to know the exact immunogenic sequences please. Further more, I am looking for the blocking peptide of this antibody, do you have any? Thank you
    • H00001952-Q01 is actually a partial recombinant protein whose sequence is as follows: SPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS. We do have three antibodies for this target, catalog numbers NLS1942, NLS1943 and NBP1-85712, which can be viewed on our website. The immunizing sequences for these antibodies are proprietary and cannot be disclosed. If there is a specific region that you are interested in, I would be happy to see whether these antibodies will target that area or not.

Secondary Antibodies

 

Isotype Controls

Additional CELSR2 Products

Bioinformatics Tool for CELSR2 Antibody (NLS1943)

Discover related pathways, diseases and genes to CELSR2 Antibody (NLS1943). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CELSR2 Antibody (NLS1943)

Discover more about diseases related to CELSR2 Antibody (NLS1943).
 

Pathways for CELSR2 Antibody (NLS1943)

View related products by pathway.

PTMs for CELSR2 Antibody (NLS1943)

Learn more about PTMs related to CELSR2 Antibody (NLS1943).
 

Research Areas for CELSR2 Antibody (NLS1943)

Find related products by research area.

Blogs on CELSR2

There are no specific blogs for CELSR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CELSR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CELSR2
Entrez
Uniprot