POMT1 Antibody

Images

 
Western Blot: POMT1 Antibody [NBP1-60054] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

POMT1 Antibody Summary

Immunogen
Synthetic peptides corresponding to POMT1(protein-O-mannosyltransferase 1) The peptide sequence was selected from the middle region of POMT1. Peptide sequence LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL.
Clonality
Polyclonal
Host
Rabbit
Gene
POMT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against POMT1 and was validated on Western blot.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for POMT1 Antibody

  • Dolichyl-phosphate-mannose--protein mannosyltransferase 1
  • EC 2.4.1
  • EC 2.4.1.109
  • FLJ37239
  • LGMD2K
  • MDDGA1
  • MDDGB1
  • MDDGC1
  • protein O-mannosyl-transferase 1
  • protein-O-mannosyltransferase 1
  • RT

Background

POMT1 is an O-mannosyltransferase that requires interaction with the product of the POMT2 gene for enzymatic function. The encoded protein is found in the membrane of the endoplasmic reticulum. Defects in this gene are a cause of Walker-Warburg syndrome (WWS) and limb-girdle muscular dystrophy type 2K (LGMD2K).O-mannosylation is an important protein modification in eukaryotes that is initiated by an evolutionarily conserved family of protein O-mannosyltransferases. POMT1 shares sequence similarity with protein O-mannosyltransferases of S. cerevisiae. In yeast, these enzymes are located in the endoplasmic reticulum (ER) and are required for cell integrity and cell wall rigidity. POMT1 also shows similarity to the Drosophila 'rotated abdomen' (rt) gene, which when mutated causes defects in myogenesis and muscle structure.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-42 DB154785.1 1-42 43-2420 AK074874.1 1-2378 2421-2617 BF984005.1 438-634 2618-3080 AL358781.19 127610-128072

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-67769
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NB120-2765
Species: Hu, Mu, Rt, Bv, Ch, GP, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000292-B01P
Species: Hu
Applications: WB, ELISA
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-87217
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
MAB4614
Species: Hu
Applications: Flow
NBP1-60082
Species: Hu
Applications: WB, IHC, IHC-P
MAB8967
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB1489
Species: Hu
Applications: WB

Publications for POMT1 Antibody (NBP1-60054) (0)

There are no publications for POMT1 Antibody (NBP1-60054).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POMT1 Antibody (NBP1-60054) (0)

There are no reviews for POMT1 Antibody (NBP1-60054). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POMT1 Antibody (NBP1-60054) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POMT1 Antibody Products

Related Products by Gene

Bioinformatics Tool for POMT1 Antibody (NBP1-60054)

Discover related pathways, diseases and genes to POMT1 Antibody (NBP1-60054). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POMT1 Antibody (NBP1-60054)

Discover more about diseases related to POMT1 Antibody (NBP1-60054).
 

Pathways for POMT1 Antibody (NBP1-60054)

View related products by pathway.

PTMs for POMT1 Antibody (NBP1-60054)

Learn more about PTMs related to POMT1 Antibody (NBP1-60054).

Blogs on POMT1

There are no specific blogs for POMT1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol POMT1
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-60054 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought