Home » PGR1 » PGR1 Research Products » PGR1 Antibody

PGR1 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining of human small intestine shows high expression.
Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining of human small intestine shows high expression.
Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining in human small intestine and pancreas tissues using anti-PTGR1 antibody. Corresponding PTGR1 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

PGR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKL
Specificity
Specificity of human PGR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTGR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
WB, IHC reported in scientific literature (PMID: 27867096). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PGR1 Protein (NBP1-87892PEP)
Publications
Read Publication using
NBP1-87892 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat reactivity reported in the scientific literature (PMID: 27867096).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGR1 Antibody

  • 15-oxoprostaglandin 13-reductase
  • EC 1.3.1.-
  • EC 1.3.1.48
  • EC 1.3.1.74
  • FLJ99229
  • leukotriene B4 12-hydroxydehydrogenase
  • LTB4DH
  • MGC34943
  • NADP-dependent leukotriene B4 12-hydroxydehydrogenase
  • PGR1
  • PRG-1
  • prostaglandin reductase 1
  • ZADH3
  • zinc binding alcohol dehydrogenase domain containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

15-PGDH/HPGD
Antibody
NB200-179
Simple Western: 15-PGDH/HPGD Antibody [NB200-179] - Simple Western lane view shows a specific band for 15-PGDH/HPGD in 0.5 mg/ml of Lovo (left) and HeLa (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunohistochemistry: 15-PGDH/HPGD Antibody [NB200-179] - Expression of 15-prostaglandin dehydrogenase (15-PGDH) in healthy and inflamed synovial tissue. Immunohistochemical staining reveals positive (brown) staining for 15-PGDH (hematoxilin counterstained) in synovial tissue from healthy individuals (a) and patients with rheumatoid arthritis (b), osteoarthritis (c), or psoriatic arthritis (d). Original magnifications: x250 (a, b), x100 (c, d). Image collected and cropped by CiteAb from the following publication (http://arthritis-research.biomedcentral.com/articles/10.1186/ar3851), licensed under a CC-BY licence.
Immunohistochemistry: 15-PGDH/HPGD Antibody [NB200-179] - Cellular localization of 15-prostaglandin dehydrogenase (15-PGDH/HPGD) in rheumatoid arthritis synovial tissue and the effects of anti-rheumatic treatment on its expression. Double-immunofluorescence images show staining for 15-PGDH/HPGD-positive (red) cells and cell marker staining (green) for macrophage CD163, fibroblast prolyl-4-hydroxylase, and endothelial cell CD31. Merged images display double-stained cells in yellow. Original magnification: x400. Image collected and cropped by CiteAb from the following publication (http://arthritis-research.biomedcentral.com/articles/10.1186/ar3851), licensed under a CC-BY licence
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Progesterone
R/NR3C3 Antibody (4E9
H00005241-M08
Western Blot: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of PGR expression in MCF-7 (Cat # L046V1).
Immunocytochemistry/Immunofluorescence: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of monoclonal antibody to PGR on MCF-7 cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
PIWIL4 Antibody
(10G9B11)
NBP2-37398
Western Blot: PIWIL4 Antibody (10G9B11) [NBP2-37398] - Western blot analysis using PIWIL4 mouse mAb against PC-3 (1) and PANC-1 (2) cell lysate.
Immunohistochemistry: PIWIL4 Antibody (10G9B11) [NBP2-37398] - Immunohistochemical analysis of paraffin-embedded rectum cancer tissues using PIWIL4 mouse mAb with DAB staining.
Flow Cytometry: PIWIL4 Antibody (10G9B11) [NBP2-37398] - Flow cytometric analysis of HeLa cells using PIWIL4 mouse mAb (green) and negative control (purple).
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
PIWIL1/HIWI
Antibody
NBP1-06062
Immunocytochemistry/Immunofluorescence: PIWIL1/HIWI Antibody [NBP1-06062] - Immunofluorescence analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunohistochemistry-Paraffin: PIWIL1/HIWI Antibody [NBP1-06062] - Staining of paraffin embedded Human Testis. Antibody at 4 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, HRP-staining.
Flow Cytometry: PIWIL1/HIWI Antibody [NBP1-06062] - Flow cytometric analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
CBR1 Antibody
NBP1-86595
Western Blot: CBR1 Antibody [NBP1-86595] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: CBR1 Antibody [NBP1-86595] - Staining of human duodenum shows strong positivity in glandular cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Lymphotoxin
beta/TNFSF3 Antibody
NBP2-14207
Immunocytochemistry/Immunofluorescence: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staining of human cell line RT4 shows localization to centrosome. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staining of human small intestine shows moderate positivity in leukocytes.
Immunohistochemistry-Paraffin: Lymphotoxin beta/TNFSF3 Antibody [NBP2-14207] - Staining of human lymph node shows strong cytoplasmic positivity in subset of non germinal and germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZADH1 Antibody
NBP2-38122
Immunocytochemistry/Immunofluorescence: ZADH1 Antibody [NBP2-38122] - Staining of human cell line A549 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ZADH1 Antibody [NBP2-38122] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ZADH1 Antibody [NBP2-38122] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Nrf2 Antibody
NBP1-32822
Western Blot: Nrf2 Antibody [NBP1-32822] - Hydralazine enhances NRF2 signaling in SH-SY5Y cells. c Hydralazine reduced the interaction between NRF2 and KEAP1. Interactions were measured by reciprocal Co-IPs followed by western blot analysis. *p < 0.05, two-tailed Student's t test, n = 3, mean +/- SD. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41467-017-02394-3), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Nrf2 Antibody [NBP1-32822] - NRF2 antibody [N2C2], Internal detects NRF2 protein at nucleus by immunofluorescent analysis.Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: NRF2 stained by NRF2 antibody [N2C2], Internal (NBP1-32822) diluted at 1:500.Red: phalloidin, a cytoskeleton marker, diluted at 1:100.
Immunohistochemistry-Paraffin: Nrf2 Antibody [NBP1-32822] - NRF2 antibody [N2C2], Internal detects NRF2 protein at cytoplasm and nucleus by immunohistochemical analysis.Sample: Paraffin-embedded human breast carcinoma.NRF2 stained by NRF2 antibody [N2C2], Internal (NBP1-32822) diluted at 1:500.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
(4 Reviews)
(27 Publications)
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
DBT Antibody
NBP1-89522
Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human colon.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
TTF2 Antibody (1E8)
H00008458-M06
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/Immunofluorescence: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of monoclonal antibody to TTF2 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in PC-12 (Cat # L012V1).
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C‑Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(11 Reviews)
(41 Publications)
Species: Hu
Applications: WB, IHC, IP
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Butyrylcholinesterase/ ...
AF9024
Western blot shows lysates of mouse heart tissue and mouse liver tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Mouse/Rat Butyrylcholinesterase/BCHE Polyclonal Antibody (Catalog # AF9024) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Butyrylcholinesterase/BCHE at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Butyrylcholinesterase/BCHE was detected in perfusion fixed frozen sections of mouse brain using Goat Anti-Mouse/Rat Butyrylcholinesterase/BCHE Antigen Affinity-purified Polyclonal Antibody (Catalog # AF9024) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit  (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to glial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Mu, Rt
Applications: WB, IHC
Elastase Antibody
(CELA3B/1257)
NBP2-53246
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-53246] - Formalin-fixed, paraffin-embedded Rat Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257).
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-53246] - Formalin-fixed, paraffin-embedded Human Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257)
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-53246] - Formalin-fixed, paraffin-embedded Mouse Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257).
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
SRGN Antibody
NBP1-80886
Western Blot: SRGN Antibody [NBP1-80886] - Analysis in human cell lines A-549 and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: SRGN Antibody [NBP1-80886] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: SRGN Antibody [NBP1-80886] - Staining of human liver shows low expression as expected.
(4 Publications)
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP
GLYAT Antibody
NBP2-58917
Western Blot: GLYAT Antibody [NBP2-58917] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human skeletal muscle.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-58917] - Staining of human duodenum shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
PHGDH Antibody
NBP1-87311
Western Blot: PHGDH Antibody [NBP1-87311] - Analysis: NBP1-87311 (A) shows similar pattern to independent antibody NBP1-87310 (B)
Immunocytochemistry/Immunofluorescence: PHGDH Antibody [NBP1-87311] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal and glial cells.
(7 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
PGD Antibody
(OTI2A5)
NBP2-45880
Western Blot: PGD Antibody (OTI2A5) [NBP2-45880] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PGD.
Immunohistochemistry-Paraffin: PGD Antibody (OTI2A5) [NBP2-45880] - Human thyroid tissue using anti-PGD mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min.
Immunohistochemistry-Paraffin: PGD Antibody (OTI2A5) [NBP2-45880] - Human pancreas tissue within the normal limits using anti-PGD mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min.
Species: Hu
Applications: WB, IHC, IHC-P, IF
CRAT Antibody
NBP1-86616
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86616] - Analysis in human testis and lymph node tissues. Corresponding CRAT RNA-seq data are presented for the same tissues.
Western Blot: CRAT Antibody [NBP1-86616] - Analysis using Anti-CRAT antibody NBP1-86616 (A) shows similar pattern to independent antibody NBP1-86615 (B).
Western Blot: CRAT Antibody [NBP1-86616] - Analysis in human cell line TD47D.
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PGR1 Antibody (NBP1-87892)(1)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for PGR1 Antibody (NBP1-87892) (0)

There are no reviews for PGR1 Antibody (NBP1-87892). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGR1 Antibody (NBP1-87892) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional PGR1 Products

Bioinformatics Tool for PGR1 Antibody (NBP1-87892)

Discover related pathways, diseases and genes to PGR1 Antibody (NBP1-87892). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGR1 Antibody (NBP1-87892)

Discover more about diseases related to PGR1 Antibody (NBP1-87892).
 

Pathways for PGR1 Antibody (NBP1-87892)

View related products by pathway.

Blogs on PGR1

There are no specific blogs for PGR1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGR1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PTGR1