PGR1 Antibody - BSA Free

Analysis in human small intestine and skeletal muscle tissues using HPA036724 antibody. Corresponding PTGR1 RNA-seq data are presented for the same tissues.

Staining of human Small intestine shows strong granular cytoplasmic positivity in glandular cells.

Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.

Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules.

Staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PGR1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTGR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB, IHC reported in scientific literature (PMID: 27867096). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PGR1 Protein (NBP1-87892PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat reactivity reported in the scientific literature (PMID: 27867096).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PGR1 Antibody - BSA Free

• 15-oxoprostaglandin 13-reductase
• EC 1.3.1.-
• EC 1.3.1.48
• EC 1.3.1.74
• FLJ99229
• leukotriene B4 12-hydroxydehydrogenase
• LTB4DH
• MGC34943
• NADP-dependent leukotriene B4 12-hydroxydehydrogenase
• PGR1
• PRG-1
• prostaglandin reductase 1
• ZADH3
• zinc binding alcohol dehydrogenase domain containing 3

Background

PGR1, or Prostaglandin reductase 1, contains a 36 kDa and a 33 kDa isoform, and is involved in the conversion of leukotriene B4 to 12-oxo-leukotriene B4. Current disease research is being conducted to determine the relationship between PGR1 and alcoholism and lung cancer. The protein is linked to the synthesis of lipoxins, leukotrienes, eoxins, protaglandins, and thromboxanes, and arachidonic acid metabolism. Through these processes, PGR1 interacts with UBC, FNBP1L, HAT1, RBBP4, and HSP90AA1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PGR1 Antibody (NBP1-87892)(1)

Publication using NBP1-87892

• Sanchez-Rodriguez R, Torres-Mena J, Quintanar-Jurado V et al. Ptgr1 expression is regulated by NRF2 in rat hepatocarcinogenesis and promotes cell proliferation and resistance to oxidative stress. Free Radic Biol Med 2016-11-18 [PMID: 27867096] (IF/IHC, WB, Human, Rat)

Bioinformatics

• Gene Symbol: PTGR1