PGR1 Antibody


Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining of human small intestine shows high expression.
Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining in human small intestine and pancreas tissues using anti-PTGR1 antibody. Corresponding PTGR1 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

PGR1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKL
Specificity of human PGR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PGR1 Protein (NBP1-87892PEP)
Read Publication using
NBP1-87892 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PGR1 Antibody

  • 15-oxoprostaglandin 13-reductase
  • EC 1.3.1.-
  • EC
  • EC
  • FLJ99229
  • leukotriene B4 12-hydroxydehydrogenase
  • LTB4DH
  • MGC34943
  • NADP-dependent leukotriene B4 12-hydroxydehydrogenase
  • PGR1
  • PRG-1
  • prostaglandin reductase 1
  • ZADH3
  • zinc binding alcohol dehydrogenase domain containing 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Ce
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Ca
Applications: WB, Flow
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PGR1 Antibody (NBP1-87892)(1)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 2 applications: IHC, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for PGR1 Antibody (NBP1-87892) (0)

There are no reviews for PGR1 Antibody (NBP1-87892). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PGR1 Antibody (NBP1-87892) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PGR1 Products

Bioinformatics Tool for PGR1 Antibody (NBP1-87892)

Discover related pathways, diseases and genes to PGR1 Antibody (NBP1-87892). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGR1 Antibody (NBP1-87892)

Discover more about diseases related to PGR1 Antibody (NBP1-87892).

Pathways for PGR1 Antibody (NBP1-87892)

View related products by pathway.

Blogs on PGR1

There are no specific blogs for PGR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PGR1 Antibody and receive a gift card or discount.


Gene Symbol PTGR1