Home » PGR1 » PGR1 Antibodies » PGR1 Antibody

PGR1 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining of human small intestine shows high expression.
Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining of human small intestine shows high expression.
Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining in human small intestine and pancreas tissues using anti-PTGR1 antibody. Corresponding PTGR1 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PGR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKL
Specificity
Specificity of human PGR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTGR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PGR1 Protein (NBP1-87892PEP)
Publications
Read Publication using
NBP1-87892 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGR1 Antibody

  • 15-oxoprostaglandin 13-reductase
  • EC 1.3.1.-
  • EC 1.3.1.48
  • EC 1.3.1.74
  • FLJ99229
  • leukotriene B4 12-hydroxydehydrogenase
  • LTB4DH
  • MGC34943
  • NADP-dependent leukotriene B4 12-hydroxydehydrogenase
  • PGR1
  • PRG-1
  • prostaglandin reductase 1
  • ZADH3
  • zinc binding alcohol dehydrogenase domain containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

15-PGDH/HPGD
Antibody
NB200-179
Western Blot: 15-PGDH/HPGD Antibody [NB200-179] - Analysis using the HRP conjugate of NB200-179. Detection of 15-PGDH in LoVo whole cell lysates using NB 200-179. Lane 1 uses a 1:6,000 dilution. Lane 2 uses a 1:1,500 dilution. ECL: 10 second exposure.
Immunocytochemistry/Immunofluorescence: 15-PGDH/HPGD Antibody [NB200-179] - 15-PGDH antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: 15-PGDH/HPGD Antibody [NB200-179] - IHC analysis of 15-PGDH in human synovial tissue from patient with rheumatoid arthritis. Image courtesy of an anonymous customer review.
(2 Reviews)
(24 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Western blot shows lysates of T47D human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) followed by HRP‑conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for PR-A and PR-B at approximately 90 and 118 kDa, respectively (as indicated). This experiment was conducted using Immunoblot Buffer Group 1.
Progesterone R/NR3C3 was detected in immersion fixed T47D human breast cancer cell line using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 1.7 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Progesterone R/NR3C3 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using Sheep Anti-Human Progesterone R/NR3C3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5415) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC, ICC
PIWIL4 Antibody
(10G9B11)
NBP2-37398
Western Blot: PIWIL4 Antibody (10G9B11) [NBP2-37398] - Western blot analysis using PIWIL4 mouse mAb against PC-3 (1) and PANC-1 (2) cell lysate.
Immunohistochemistry: PIWIL4 Antibody (10G9B11) [NBP2-37398] - Immunohistochemical analysis of paraffin-embedded rectum cancer tissues using PIWIL4 mouse mAb with DAB staining.
Flow Cytometry: PIWIL4 Antibody (10G9B11) [NBP2-37398] - Flow cytometric analysis of HeLa cells using PIWIL4 mouse mAb (green) and negative control (purple).
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
PIWIL1/HIWI
Antibody
AF6548
PIWIL1/HIWI was detected in perfusion fixed frozen sections of mouse testes using Goat Anti-Human PIWIL1/HIWI Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6548) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Northern­Lights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to the cytoplasm of spermatocytes. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Species: Hu, Mu
Applications: IHC
CBR1 Antibody
NBP1-86595
Western Blot: CBR1 Antibody [NBP1-86595] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: CBR1 Antibody [NBP1-86595] - Staining of human duodenum shows strong positivity in glandular cells.
Western Blot: CBR1 Antibody [NBP1-86595] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Lymphotoxin
beta/TNFSF3 Antibody ...
MAB1684
Lymphotoxin beta/TNFSF3 Antibody (135105)
(2 Publications)
Species: Hu
Applications: WB
ZADH1 Antibody
NBP2-38122
Immunocytochemistry/Immunofluorescence: ZADH1 Antibody [NBP2-38122] - Staining of human cell line A549 shows localization to vesicles.
Immunohistochemistry: ZADH1 Antibody [NBP2-38122] - Staining of human thyroid gland shows moderate cytoplasmic and nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Nrf2 Antibody
NBP1-32822
Western Blot: Nrf2 Antibody [NBP1-32822] - Non-transfected (-) and NRF2-transfected (+, including 3xFlag-tag) 293T whole cell extracts (30ug) were separated by 5% SDS-PAGE, and the membrane was blotted with NRF2 antibody diluted by 1:1000.
Immunocytochemistry/Immunofluorescence: Nrf2 Antibody [NBP1-32822] - NIH/3T3 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: NRF2 protein stained by NRF2 antibody [N2C2], Internal diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: Nrf2 Antibody [NBP1-32822] - Paraffin-embedded Cal27 xenograft, using Nrf2 antibody at 1:500 dilution.
(3 Reviews)
(4 Publications)
Species: Hu, Mu, Rt, Av, Ce
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
DBT Antibody
NBP1-89522
Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining in human kidney and pancreas tissues using anti-DBT antibody. Corresponding DBT RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
TTF2 Antibody
(1E8.)
H00008458-M06
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/Immunofluorescence: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of monoclonal antibody to TTF2 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in PC-12 (Cat # L012V1).
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C‑Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(11 Reviews)
(36 Publications)
Species: Hu
Applications: WB, IHC, IP
Catalase Antibody
NBP2-24916
Western Blot: Catalase Antibody [NBP2-24916] - Analysis in liver lysate of 1) human 2) mouse and 3) rat at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Catalase Antibody [NBP2-24916] - Staining of human liver tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Butyrylcholinesterase/ ...
NBP2-03523
Western Blot: Butyrylcholinesterase Antibody (1E1) [NBP2-03523] Analysis of extracts (35ug) from 9 different cell lines by using anti-Butyrylcholinesterase monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Flow Cytometry: Butyrylcholinesterase Antibody (1E1) [NBP2-03523] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Butyrylcholinesterase antibody, and then analyzed by flow cytometry.
Western Blot: Butyrylcholinesterase Antibody (1E1) [NBP2-03523] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Butyrylcholinesterase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Butyrylcholinesterase.
Species: Hu, Ca
Applications: WB, Flow
Elastase Antibody
(CELA3B/1257)
NBP2-47645
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-47645] - Formalin-fixed, paraffin-embedded Mouse Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257).
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-47645] - Formalin-fixed, paraffin-embedded Human Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257)
Immunohistochemistry-Paraffin: Elastase Antibody (CELA3B/1257) [NBP2-47645] - Formalin-fixed, paraffin-embedded Rat Pancreas stained with CELA3B Monoclonal Antibody (CELA3B/1257).
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
SRGN Antibody
NBP1-80886
Western Blot: SRGN Antibody [NBP1-80886] - Analysis in human cell line HL-60.
Immunohistochemistry-Paraffin: SRGN Antibody [NBP1-80886] - Staining in human bone marrow and liver tissues using anti-SRGN antibody. Corresponding SRGN RNA-seq data are presented for the same tissues.
Western Blot: SRGN Antibody [NBP1-80886] - Analysis in human cell lines A-549 and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
(4 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
GLYAT Antibody
NBP2-55298
Western Blot: GLYAT Antibody [NBP2-55298] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-55298] - Staining in human kidney and skeletal muscle tissues using anti-GLYAT antibody. Corresponding GLYAT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: GLYAT Antibody [NBP2-55298] - Staining of human kidney shows high expression.
Species: Hu
Applications: WB, IHC, IHC-P
PHGDH Antibody
NBP1-87311
Western Blot: PHGDH Antibody [NBP1-87311] - Analysis in human cell lines SK-MEL-30 and A-549. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunocytochemistry/Immunofluorescence: PHGDH Antibody [NBP1-87311] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal and glial cells.
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
PGD Antibody
NBP1-31589
Western Blot: PGD Antibody [NBP1-31589] - Mouse tissue extracts (50 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with PGD antibody [N1N3] diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: PGD Antibody [NBP1-31589] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: PGD protein stained by PGD antibody [N1N3] diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: PGD Antibody [NBP1-31589] - protein at cytoplasm on A549 xenograft by immunohistochemical analysis. Sample: Paraffin-embedded A549 xenograft.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
CRAT Antibody
NBP1-86614
Western Blot: CRAT Antibody [NBP1-86614] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86614] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: CRAT Antibody [NBP1-86614] - Analysis in human testis and tonsil tissues using Anti-CRAT antibody. Corresponding CRAT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PGR1 Antibody (NBP1-87892)(1)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for PGR1 Antibody (NBP1-87892) (0)

There are no reviews for PGR1 Antibody (NBP1-87892). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PGR1 Antibody (NBP1-87892) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PGR1 Products

Bioinformatics Tool for PGR1 Antibody (NBP1-87892)

Discover related pathways, diseases and genes to PGR1 Antibody (NBP1-87892). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGR1 Antibody (NBP1-87892)

Discover more about diseases related to PGR1 Antibody (NBP1-87892).
 

Pathways for PGR1 Antibody (NBP1-87892)

View related products by pathway.

Blogs on PGR1

There are no specific blogs for PGR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGR1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PTGR1