PGR1 Antibody

Images

 
Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining of human small intestine shows high expression.
Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PGR1 Antibody [NBP1-87892] - Staining in human small intestine and pancreas tissues using anti-PTGR1 antibody. Corresponding PTGR1 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PGR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTGR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB, IHC reported in scientific literature (PMID: 27867096). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PGR1 Protein (NBP1-87892PEP)
Publications
Read Publication using
NBP1-87892 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat reactivity reported in the scientific literature (PMID: 27867096).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGR1 Antibody

  • 15-oxoprostaglandin 13-reductase
  • EC 1.3.1.-
  • EC 1.3.1.48
  • EC 1.3.1.74
  • FLJ99229
  • leukotriene B4 12-hydroxydehydrogenase
  • LTB4DH
  • MGC34943
  • NADP-dependent leukotriene B4 12-hydroxydehydrogenase
  • PGR1
  • PRG-1
  • prostaglandin reductase 1
  • ZADH3
  • zinc binding alcohol dehydrogenase domain containing 3

Background

PGR1, or Prostaglandin reductase 1, contains a 36 kDa and a 33 kDa isoform, and is involved in the conversion of leukotriene B4 to 12-oxo-leukotriene B4. Current disease research is being conducted to determine the relationship between PGR1 and alcoholism and lung cancer. The protein is linked to the synthesis of lipoxins, leukotrienes, eoxins, protaglandins, and thromboxanes, and arachidonic acid metabolism. Through these processes, PGR1 interacts with UBC, FNBP1L, HAT1, RBBP4, and HSP90AA1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PGR1 Antibody (NBP1-87892)(1)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 2 applications: IF/IHC, WB.


Filter By Application
IF/IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for PGR1 Antibody (NBP1-87892) (0)

There are no reviews for PGR1 Antibody (NBP1-87892). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGR1 Antibody (NBP1-87892) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PGR1 Products

Research Areas for PGR1 Antibody (NBP1-87892)

Find related products by research area.

Blogs on PGR1

There are no specific blogs for PGR1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGR1