Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKL |
Specificity | Specificity of human PGR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PTGR1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | WB, IHC reported in scientific literature (PMID: 27867096). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-87892 | Applications | Species |
---|---|---|
Sanchez-Rodriguez R, Torres-Mena J, Quintanar-Jurado V et al. Ptgr1 expression is regulated by NRF2 in rat hepatocarcinogenesis and promotes cell proliferation and resistance to oxidative stress. Free Radic Biol Med 2016 Nov 18 [PMID: 27867096] (WB, IHC, Rat, Human) | WB, IHC | Rat, Human |
Secondary Antibodies |
Isotype Controls |
Diseases for PGR1 Antibody (NBP1-87892)Discover more about diseases related to PGR1 Antibody (NBP1-87892).
| Pathways for PGR1 Antibody (NBP1-87892)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | PTGR1 |