SRGN Antibody

Images

 
Western Blot: SRGN Antibody [NBP1-80886] - Analysis in human cell line HL-60.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SRGN Antibody [NBP1-80886] - Staining in human bone marrow and liver tissues using anti-SRGN antibody. Corresponding SRGN RNA-seq data are presented for the ...read more
Orthogonal Strategies: Western Blot: SRGN Antibody [NBP1-80886] - Analysis in human cell lines A-549 and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: SRGN Antibody [NBP1-80886] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: SRGN Antibody [NBP1-80886] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SRGN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDE
Specificity
Specificity of human SRGN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRGN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
SRGN Lysate (NBP2-65395)
Control Peptide
SRGN Protein (NBP1-80886PEP)
Publications
Read Publications using
NBP1-80886 in the following applications:

  • 1 publication
  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24403068).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SRGN Antibody

  • FLJ12930
  • Hematopoetic proteoglycan core protein
  • MGC9289
  • P.PG
  • Platelet proteoglycan core protein
  • platelet proteoglycan protein core
  • PPG
  • PRG1p.PG
  • PRGhematopoetic proteoglycan core peptide
  • proteoglycan 1, secretory granule
  • proteoglycan protein core for mast cell secretory granule
  • secretory granule proteoglycan 1
  • secretory granule proteoglycan core peptide
  • Secretory granule proteoglycan core protein
  • serglycin proteoglycan
  • serglycin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-76802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001491-M01
Species: Hu, GP
Applications: WB, ELISA, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
7270-IL/CF
Species: Hu
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-66786
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85296
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83314
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13878
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80886
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SRGN Antibody (NBP1-80886)(4)

Reviews for SRGN Antibody (NBP1-80886) (0)

There are no reviews for SRGN Antibody (NBP1-80886). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRGN Antibody (NBP1-80886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SRGN Antibody (NBP1-80886)

Discover related pathways, diseases and genes to SRGN Antibody (NBP1-80886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRGN Antibody (NBP1-80886)

Discover more about diseases related to SRGN Antibody (NBP1-80886).
 

Pathways for SRGN Antibody (NBP1-80886)

View related products by pathway.

PTMs for SRGN Antibody (NBP1-80886)

Learn more about PTMs related to SRGN Antibody (NBP1-80886).

Blogs on SRGN

There are no specific blogs for SRGN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRGN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRGN