Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE |
Specificity | Specificity of human CBR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CBR1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Theoretical MW | 30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Control |
|
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-86595 | Applications | Species |
---|---|---|
Yun M, Choi AJ, Lee YC et al. Carbonyl reductase 1 is a new target to improve the effect of radiotherapy on head and neck squamous cell carcinoma. Oncol Lett. Nov 12 2018 [PMID: 30376862] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for CBR1 Antibody (NBP1-86595)Discover more about diseases related to CBR1 Antibody (NBP1-86595).
| Pathways for CBR1 Antibody (NBP1-86595)View related products by pathway.
|
PTMs for CBR1 Antibody (NBP1-86595)Learn more about PTMs related to CBR1 Antibody (NBP1-86595).
| Research Areas for CBR1 Antibody (NBP1-86595)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.