CBR1 Antibody

Western Blot: CBR1 Antibody [NBP1-86595] - Analysis in human cell line A-549.

Immunohistochemistry-Paraffin: CBR1 Antibody [NBP1-86595] - Staining of human duodenum shows strong positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CBR1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE
• Predicted Species: Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CBR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  CBR1 Protein (NBP1-86595PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CBR1 Antibody

• 15-hydroxyprostaglandin dehydrogenase [NADP+]
• carbonyl reductase (NADPH) 1
• carbonyl reductase (NADPH) 1, EC 1.1.1.18410EC 1.1.1.197,15-hydroxyprostaglandin dehydrogenase
• carbonyl reductase [NADPH] 1
• carbonyl reductase 1
• CBR
• CRN
• EC 1.1.1.184
• EC 1.1.1.189
• hCBR1
• NADPH-dependent carbonyl reductase 1
• Prostaglandin 9-ketoreductase
• Prostaglandin-E(2) 9-reductase
• SDR21C1
• short chain dehydrogenase/reductase family 21C, member 1

Background

Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. Another carbonyl reductase gene, CRB3, lies close to this gene on chromosome 21q.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CBR1 Antibody (NBP1-86595)(4)

Publications using NBP1-86595

• Yokoyama M, Fujita T, Kadonosawa Y et al. Development of transgenic mice overexpressing mouse carbonyl reductase 1 Molecular biology reports 2022-11-09 [PMID: 36352178]
• Lee MK, Noh JK, Woo SR et al. Prognostic Significance of the BIRC2-BIRC3 Gene Signature in Head and Neck Squamous Cell Carcinoma Cancer genomics & proteomics 2022-08-19 [PMID: 35985688] (WB, Human)
• Bell R, Villalobos E, Nixon M et al. Carbonyl reductase 1 amplifies glucocorticoid action in adipose tissue and impairs glucose tolerance in lean mice Molecular metabolism 2021-03-27 [PMID: 33785425] (WB, Mouse)
• Yun M, Choi AJ, Lee YC et al. Carbonyl reductase 1 is a new target to improve the effect of radiotherapy on head and neck squamous cell carcinoma. Oncol Lett. 2018-11-12 [PMID: 30376862] (WB, Human)

Bioinformatics

• Gene Symbol: CBR1
• Entrez:
  • 873(Human)
• Uniprot:
  • P16152(Human)