CBR1 Antibody

Images

 
Western Blot: CBR1 Antibody [NBP1-86595] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: CBR1 Antibody [NBP1-86595] - Staining of human duodenum shows strong positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CBR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE
Specificity
Specificity of human CBR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CBR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control
CBR1 Knockout A549 Cell Lysate
Control Peptide
CBR1 Protein (NBP1-86595PEP)
Publications
Read Publication using
NBP1-86595 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CBR1 Antibody

  • 15-hydroxyprostaglandin dehydrogenase [NADP+]
  • carbonyl reductase (NADPH) 1
  • carbonyl reductase (NADPH) 1, EC 1.1.1.18410EC 1.1.1.197,15-hydroxyprostaglandin dehydrogenase
  • carbonyl reductase [NADPH] 1
  • carbonyl reductase 1
  • CBR
  • CRN
  • EC 1.1.1.184
  • EC 1.1.1.189
  • hCBR1
  • NADPH-dependent carbonyl reductase 1
  • Prostaglandin 9-ketoreductase
  • Prostaglandin-E(2) 9-reductase
  • SDR21C1
  • short chain dehydrogenase/reductase family 21C, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-179
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45880
Species: Hu
Applications: WB, IHC, IHC-P, IF
NB100-41398
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-00997
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-87852
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00005241-M08
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP3-05061
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-13349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
NBP2-02105
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CBR1 Antibody (NBP1-86595)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CBR1 Antibody (NBP1-86595) (0)

There are no reviews for CBR1 Antibody (NBP1-86595). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CBR1 Antibody (NBP1-86595) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CBR1 Products

Bioinformatics Tool for CBR1 Antibody (NBP1-86595)

Discover related pathways, diseases and genes to CBR1 Antibody (NBP1-86595). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBR1 Antibody (NBP1-86595)

Discover more about diseases related to CBR1 Antibody (NBP1-86595).
 

Pathways for CBR1 Antibody (NBP1-86595)

View related products by pathway.

PTMs for CBR1 Antibody (NBP1-86595)

Learn more about PTMs related to CBR1 Antibody (NBP1-86595).
 

Research Areas for CBR1 Antibody (NBP1-86595)

Find related products by research area.

Blogs on CBR1

There are no specific blogs for CBR1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CBR1
Entrez
Uniprot