![Western Blot: CBR1 Antibody [NBP1-86595] - Analysis in human cell line A-549.](http://images.novusbio.com/fullsize2/CBR1-Antibody-Western-Blot-NBP1-86595-img0007.jpg "Western Blot: CBR1 Antibody [NBP1-86595] - Analysis in human cell line A-549.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE |
| Specificity | Specificity of human CBR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CBR1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control |
|
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-86595 | Applications | Species |
|---|---|---|
| Yun M, Choi AJ, Lee YC et al. Carbonyl reductase 1 is a new target to improve the effect of radiotherapy on head and neck squamous cell carcinoma. Oncol Lett. Nov 12 2018 [PMID: 30376862] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for CBR1 Antibody (NBP1-86595)Discover more about diseases related to CBR1 Antibody (NBP1-86595).
| Pathways for CBR1 Antibody (NBP1-86595)View related products by pathway.
|
PTMs for CBR1 Antibody (NBP1-86595)Learn more about PTMs related to CBR1 Antibody (NBP1-86595).
| Research Areas for CBR1 Antibody (NBP1-86595)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: CBR1 Antibody [NBP1-86595] - Staining of human duodenum shows strong positivity in glandular cells.](http://images.novusbio.com/fullsize2/CBR1-Antibody-Immunohistochemistry-Paraffin-NBP1-86595-img0001.jpg "Immunohistochemistry-Paraffin: CBR1 Antibody [NBP1-86595] - Staining of human duodenum shows strong positivity in glandular cells.")
![Simple Western: 15-PGDH/HPGD Antibody [NB200-179] - Simple Western lane view shows a specific band for 15-PGDH/HPGD in 0.5 mg/ml of Lovo (left) and HeLa (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/images2/15-PGDH-HPGD-Antibody-Simple-Western-NB200-179-img0005.jpg)
![Immunohistochemistry: 15-PGDH/HPGD Antibody [NB200-179] - Expression of 15-prostaglandin dehydrogenase (15-PGDH) in healthy and inflamed synovial tissue. Immunohistochemical staining reveals positive (brown) staining for 15-PGDH (hematoxilin counterstained) in synovial tissue from healthy individuals (a) and patients with rheumatoid arthritis (b), osteoarthritis (c), or psoriatic arthritis (d). Original magnifications: x250 (a, b), x100 (c, d). Image collected and cropped by CiteAb from the following publication (http://arthritis-research.biomedcentral.com/articles/10.1186/ar3851), licensed under a CC-BY licence.](http://images.novusbio.com/images2/15-PGDH-HPGD-Antibody-Immunohistochemistry-NB200-179-img0015.jpg)
![Immunohistochemistry: 15-PGDH/HPGD Antibody [NB200-179] - Cellular localization of 15-prostaglandin dehydrogenase (15-PGDH/HPGD) in rheumatoid arthritis synovial tissue and the effects of anti-rheumatic treatment on its expression. Double-immunofluorescence images show staining for 15-PGDH/HPGD-positive (red) cells and cell marker staining (green) for macrophage CD163, fibroblast prolyl-4-hydroxylase, and endothelial cell CD31. Merged images display double-stained cells in yellow. Original magnification: x400. Image collected and cropped by CiteAb from the following publication (http://arthritis-research.biomedcentral.com/articles/10.1186/ar3851), licensed under a CC-BY licence](http://images.novusbio.com/images2/15-PGDH-HPGD-Antibody-Immunohistochemistry-NB200-179-img0016.jpg)
![Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded colon carcinoma stained with COX-2 antibody (NB100-689).](http://images.novusbio.com/images2/COX-2-Antibody-Immunohistochemistry-Paraffin-NB100-689-img0010.jpg)
![Simple Western: COX-2 Antibody [NB100-689] - Simple Western lane view shows a specific band for COX2 in 1.0 mg/ml of Rat Brain at an antibody concentration of 1:100. This experiment was performed under reducing conditions using the 12-230 kDa separation system. Image provided through customer review.](http://images.novusbio.com/images2/COX-2-Antibody-Simple-Western-NB100-689-img0003.jpg)
![Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/images2/DBT-Antibody-Western-Blot-NBP1-89522-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/images2/DBT-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89522-img0007.jpg)
![Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human colon.](http://images.novusbio.com/images2/DBT-Antibody-Immunohistochemistry-Paraffin-NBP1-89522-img0015.jpg)
![Western Blot: PHGDH Antibody [NBP1-87311] - Analysis: NBP1-87311 (A) shows similar pattern to independent antibody NBP1-87310 (B)](http://images.novusbio.com/images2/PHGDH-Antibody-Western-Blot-NBP1-87311-img0021.jpg)
![Immunocytochemistry/Immunofluorescence: PHGDH Antibody [NBP1-87311] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/PHGDH-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87311-img0016.jpg)
![Immunohistochemistry-Paraffin: PHGDH Antibody [NBP1-87311] - Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal and glial cells.](http://images.novusbio.com/images2/PHGDH-Antibody-Immunohistochemistry-Paraffin-NBP1-87311-img0013.jpg)
![Western Blot: PGD Antibody (OTI2A5) [NBP2-45880] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PGD.](http://images.novusbio.com/images2/PGD-Antibody-(OTI2A5)-Western-Blot-NBP2-45880-img0010.jpg)
![Immunohistochemistry-Paraffin: PGD Antibody (OTI2A5) [NBP2-45880] - Human thyroid tissue using anti-PGD mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min.](http://images.novusbio.com/images2/PGD-Antibody-(OTI2A5)-Immunohistochemistry-NBP2-45880-img0009.jpg)
![Immunohistochemistry-Paraffin: PGD Antibody (OTI2A5) [NBP2-45880] - Human pancreas tissue within the normal limits using anti-PGD mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100 degrees C for 10min.](http://images.novusbio.com/images2/PGD-Antibody-(OTI2A5)-Immunohistochemistry-NBP2-45880-img0002.jpg)
![Western Blot: PBR Antibody [NB100-41398] - Staining of A431 cell lysate.(35 ug protein in RIPA buffer). Antibody at 0.3 ug/mL. Detected by chemiluminescence.](http://images.novusbio.com/images2/PBR-Antibody-Western-Blot-NB100-41398-img0011.jpg)
![Immunocytochemistry/Immunofluorescence: PBR Antibody [NB100-41398] - Immunofluorescence analysis of paraformaldehyde fixed MCF7 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).](http://images.novusbio.com/images2/PBR-Antibody-Immunocytochemistry-Immunofluorescence-NB100-41398-img0010.jpg)
![Immunohistochemistry-Paraffin: PBR Antibody [NB100-41398] - Staining of paraffin embedded Human Kidney. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/images2/PBR-Antibody-Immunohistochemistry-Paraffin-NB100-41398-img0007.jpg)
![Western Blot: CBR3 Antibody (1G6) [NBP2-00997] Analysis of extracts (35ug) from 9 different cell lines by using anti-CBR3 monoclonal antibody.](http://images.novusbio.com/images/CBR3 Antibody (1G6)-Western Blot-NBP2-00997-img0009.jpg)
![Immunohistochemistry-Paraffin: CBR3 Antibody (1G6) [NBP2-00997] - Staining of paraffin-embedded Human prostate tissue using anti-CBR3 mouse monoclonal antibody.](http://images.novusbio.com/images/CBR3 Antibody (1G6)-Immunohistochemistry-Paraffin-NBP2-00997-img0008.jpg)
![Western Blot: CBR3 Antibody (1G6) [NBP2-00997] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CBR3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-CBR3.](http://images.novusbio.com/images/CBR3 Antibody (1G6)-Western Blot-NBP2-00997-img0001.jpg)
![Western Blot: Prostaglandin E Synthase Antibody [NBP1-87852] - Analysis in human cell lines A-549 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/images2/Prostaglandin-E-Synthase-Antibody-Western-Blot-NBP1-87852-img0018.jpg)
![Immunocytochemistry/Immunofluorescence: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human cell line SiHa shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/images2/Prostaglandin-E-Synthase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87852-img0010.jpg)
![Immunohistochemistry-Paraffin: Prostaglandin E Synthase Antibody [NBP1-87852] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.](http://images.novusbio.com/images2/Prostaglandin-E-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-87852-img0024.jpg)
![Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.](http://images.novusbio.com/images2/Coagulation-Factor-II-Thrombin-Antibody-Western-Blot-NBP1-58268-img0007.jpg)
![Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.](http://images.novusbio.com/images2/Coagulation-Factor-II-Thrombin-Antibody-Immunohistochemistry-NBP1-58268-img0008.jpg)
![Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue](http://images.novusbio.com/images2/Coagulation-Factor-II-Thrombin-Antibody-Immunohistochemistry-Paraffin-NBP1-58268-img0005.jpg)
![Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in NIH/3T3 (Cat # L018V1).](http://images.novusbio.com/images2/TTF2-Antibody-(1E8)-Western-Blot-H00008458-M06-img0011.jpg)
![Immunocytochemistry/Immunofluorescence: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of monoclonal antibody to TTF2 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/images2/TTF2-Antibody-(1E8)-Immunocytochemistry-Immunofluorescence-H00008458-M06-img0007.jpg)
![Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in PC-12 (Cat # L012V1).](http://images.novusbio.com/images2/TTF2-Antibody-(1E8)-Western-Blot-H00008458-M06-img0008.jpg)
![Western Blot: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of PGR expression in MCF-7 (Cat # L046V1).](http://images.novusbio.com/images2/Progesterone-R-NR3C3-Antibody-(4E9)-Western-Blot-H00005241-M08-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of monoclonal antibody to PGR on MCF-7 cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/images2/Progesterone-R-NR3C3-Antibody-(4E9)-Immunocytochemistry-Immunofluorescence-H00005241-M08-img0006.jpg)
![Immunohistochemistry-Paraffin: Progesterone R/NR3C3 Antibody (4E9) [H00005241-M08] - Analysis of monoclonal antibody to PGR on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml](http://images.novusbio.com/images2/Progesterone-R-NR3C3-Antibody-(4E9)-Immunohistochemistry-Paraffin-H00005241-M08-img0007.jpg)
![Western Blot: MID1 Antibody [NBP3-05061] - analysis of extracts of HeLa cells, using MID1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 60s.](http://images.novusbio.com/images2/MID1-Antibody-Western-Blot-NBP3-05061-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: MID1 Antibody [NBP3-05061] - Analysis of MCF-7 cells using MID1 antibody. Blue: DAPI for nuclear staining.](http://images.novusbio.com/images2/MID1-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-05061-img0001.jpg)
![Western Blot: MID1 Antibody [NBP3-05061] - Analysis of extracts of various cell lines, using MID1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit](http://images.novusbio.com/images2/MID1 Antibody-Western Blot-NBP3-05061-img0002.jpg)
![Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Staining in human seminal vesicle and skeletal muscle tissues. Corresponding SLCO2A1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/SLCO2A1-Antibody-Immunohistochemistry-Paraffin-NBP2-13349-img0012.jpg)
![Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human prostate shows strong membranous positivity in endothelial cells.](http://images.novusbio.com/images2/SLCO2A1-Antibody-Immunohistochemistry-Paraffin-NBP2-13349-img0005.jpg)
![Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human seminal vesicle shows strong membranous positivity in glandular cells.](http://images.novusbio.com/images2/SLCO2A1-Antibody-Immunohistochemistry-Paraffin-NBP2-13349-img0006.jpg)
![Immunohistochemistry: SH3BP4 Antibody [NBP1-86274] - Staining of human small intestine shows strong luminal membranous positivity in glandular cells.](http://images.novusbio.com/images2/SH3BP4-Antibody-Immunohistochemistry-NBP1-86274-img0004.jpg)
![Inhibition of T-cells: SH3BP4 Antibody [NBP1-86274] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Hep-G2](http://images.novusbio.com/images2/SH3BP4-Antibody-Inhibition-of-T-cells-NBP1-86274-img0005.jpg)
![Western Blot: TTP Antibody (8B5) [NBP2-02105] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TTP (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-TTP.](http://images.novusbio.com/images/TTP Antibody (8B5)-Western Blot-NBP2-02105-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: TTP Antibody (OTI8B5) [NBP2-02105] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY TTP.](http://images.novusbio.com/images2/TTP-Antibody-(8B5)-Immunocytochemistry-Immunofluorescence-NBP2-02105-img0009.jpg)
![Immunohistochemistry-Paraffin: TTP Antibody (8B5) [NBP2-02105] - Staining of paraffin-embedded Human prostate tissue using anti-TTP mouse monoclonal antibody.](http://images.novusbio.com/images/TTP Antibody (8B5)-Immunohistochemistry-Paraffin-NBP2-02105-img0007.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")