TTF2 Antibody (1E8)

Images

 
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/ Immunofluorescence: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of monoclonal antibody to TTF2 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in PC-12 (Cat # L012V1).
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in Hela S3 NE (Cat # L013V3).
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in Y-79 (Cat # L042V1).
Western Blot: TTF2 Antibody (1E8) [H00008458-M06] - Analysis of TTF2 expression in human placenta.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1E8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TTF2 Antibody (1E8) Summary

Immunogen
TTF2 (NP_003585, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEVRCPEHGTFCFLKTGVRDGPNKGKSFYVCRADTCSFVRATDIPVSHCLLHEDFVVELQGLLLPQDKKEYRLFFRCIRSKAEGKRWCGSIPWQDPDSK
Specificity
TTF2 (1E8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TTF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate, tissue lysate and recombinant protein for WB. It has been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TTF2 Antibody (1E8)

  • EC 3.6.1
  • EC 3.6.4.-
  • F2
  • HuF2lodestar protein
  • human factor 2
  • Lodestar homolog
  • RNA polymerase II termination factor
  • Transcription release factor 2
  • transcription termination factor 2
  • transcription termination factor, RNA polymerase II

Background

This gene encodes a member of the SWI2/SNF2 family of proteins, which play a critical role in altering protein-DNA interactions. The encoded protein has been shown to have dsDNA-dependent ATPase activity and RNA polymerase II termination activity. This protein interacts with cell division cycle 5-like, associates with human splicing complexes, and plays a role in pre-mRNA splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02042
Species: Hu
Applications: WB, Flow, ICC/IF
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-53246
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TTF2 Antibody (H00008458-M06) (0)

There are no publications for TTF2 Antibody (H00008458-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTF2 Antibody (H00008458-M06) (0)

There are no reviews for TTF2 Antibody (H00008458-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TTF2 Antibody (H00008458-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TTF2 Products

Array H00008458-M06

Bioinformatics Tool for TTF2 Antibody (H00008458-M06)

Discover related pathways, diseases and genes to TTF2 Antibody (H00008458-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTF2 Antibody (H00008458-M06)

Discover more about diseases related to TTF2 Antibody (H00008458-M06).
 

Pathways for TTF2 Antibody (H00008458-M06)

View related products by pathway.

PTMs for TTF2 Antibody (H00008458-M06)

Learn more about PTMs related to TTF2 Antibody (H00008458-M06).

Blogs on TTF2

There are no specific blogs for TTF2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTF2 Antibody (1E8) and receive a gift card or discount.

Bioinformatics

Gene Symbol TTF2
Entrez
OMIM
Uniprot