Pax6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Pax6 Antibody [NBP1-89100] - Staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Pax6 Antibody [NBP1-89100] - Staining of human endometrium shows no positivity as expected.

Immunohistochemistry-Paraffin: Pax6 Antibody [NBP1-89100] - Staining of human pancreas shows strong nuclear positivity in islet cells.

Immunohistochemistry-Paraffin: Pax6 Antibody [NBP1-89100] - Staining of human cerebellum shows moderate to strong nuclear positivity in cells in granular layer

Immunohistochemistry-Paraffin: Pax6 Antibody [NBP1-89100] - Staining of human stomach shows strong nuclear positivity in a subset glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Pax6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Pax6 Antibody - BSA Free (NBP1-89100) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Pax6 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYW
• Marker: Neural Marker
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAX6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF fixation permeabilization: PFA/Triton X-100
• Control Peptide:

  Pax6 Protein (NBP1-89100PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Pax6 Antibody - BSA Free

• keratitis)
• MGC17209
• Oculorhombin
• paired box 6
• paired box protein Pax-6
• Pax6

Background

PAX genes encode nuclear transcription factors which are regarded as major controllers of developmental processes in both vertebrates and invertebrates. Mutations in murine PAX genes underlie three natural mouse alleles and several corresponding human syndromes (aniridia, foveal hypoplasia and Peters® anomaly). Murine PAX genes have been shown to be proto-oncogenes. Furthermore, human PAX genes have recently been demonstrated to play an influential part in some common human cancers such as brain tumors and lymphomas. All PAX genes encode a DNA-binding domain termed the paired domain and in addition some also encode a second binding domain--the paired type homeobox. PAX6 is involved in the early development of the optical vesicle and has been shown to interact with Six3, another important visual development protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Pax6 Antibody (NBP1-89100)(2)

Publications using NBP1-89100

• Tynianskaia L, E?iyok N, Huttner WB, Heide M Targeted Microinjection and Electroporation of Primate Cerebral Organoids for Genetic Modification Journal of visualized experiments : JoVE 2023-03-24 [PMID: 37036224]
• Pai B, Tome-Garcia J, Cheng WS Et al. High-resolution transcriptomics informs glial pathology in human temporal lobe epilepsy Acta Neuropathol Commun 2022-10-24 [PMID: 36274170] (IHC-P, Human)
  
  Details:
  Citation using the Azide and BSA Free version of this antibody.

FAQs for Pax6 Antibody (NBP1-89100). (Showing 1 - 1 of 1 FAQs).

1. What PAX6 antibody is recommend to use in ICC staining of human stem cells differentiated neural precursors?
   • By performing a search on PAX6 then refining this to antibodies which have been validated with human samples and for ICC, I can see that we have three products to meet your requirements. You can see all three of these antibodies. These products are listed based on sales and citations, however all of our antibodies are covered by our 100% guarantee to work in the species and applications listed on our website and on our product datasheets. You can read more about our quality guarantee here.

Bioinformatics

• Gene Symbol: PAX6
• Entrez:
  • 5080(Human)
  • 18508(Mouse)
  • 25509(Rat)
• Uniprot:
  • P26367()