Pax6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Pax6 Antibody [NBP1-89100] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Pax6 Antibody [NBP1-89100] - Staining of human pancreas shows strong nuclear positivity in islet cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pax6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYW
Marker
Neural Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAX6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence fixation permeabilization: PFA/Triton X-100
Control Peptide
Pax6 Protein (NBP1-89100PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pax6 Antibody

  • keratitis)
  • MGC17209
  • Oculorhombin
  • paired box 6
  • paired box protein Pax-6
  • Pax6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
AF2746
Species: Hu, Mu
Applications: WB, ICC
H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-49672
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82554
Species: Hu
Applications: WB, IHC, IHC-P
H00006496-M04
Species: Hu
Applications: WB, ELISA
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF3444
Species: Hu
Applications: WB
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
H00338917-T01
Species: Hu
NBP1-89100
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Pax6 Antibody (NBP1-89100) (0)

There are no publications for Pax6 Antibody (NBP1-89100).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pax6 Antibody (NBP1-89100) (0)

There are no reviews for Pax6 Antibody (NBP1-89100). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Pax6 Antibody (NBP1-89100). (Showing 1 - 1 of 1 FAQ).

  1. What PAX6 antibody is recommend to use in ICC staining of human stem cells differentiated neural precursors?
    • By performing a search on PAX6 then refining this to antibodies which have been validated with human samples and for ICC, I can see that we have three products to meet your requirements. You can see all three of these antibodies. These products are listed based on sales and citations, however all of our antibodies are covered by our 100% guarantee to work in the species and applications listed on our website and on our product datasheets. You can read more about our quality guarantee here.

Secondary Antibodies

 

Isotype Controls

Additional Pax6 Products

Bioinformatics Tool for Pax6 Antibody (NBP1-89100)

Discover related pathways, diseases and genes to Pax6 Antibody (NBP1-89100). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pax6 Antibody (NBP1-89100)

Discover more about diseases related to Pax6 Antibody (NBP1-89100).
 

Pathways for Pax6 Antibody (NBP1-89100)

View related products by pathway.

PTMs for Pax6 Antibody (NBP1-89100)

Learn more about PTMs related to Pax6 Antibody (NBP1-89100).
 

Research Areas for Pax6 Antibody (NBP1-89100)

Find related products by research area.

Blogs on Pax6

There are no specific blogs for Pax6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pax6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAX6
Entrez
Uniprot