CHX10 Antibody

Images

 
Western Blot: CHX10 Antibody [NBP1-84476] - Analysis in control (vector only transfected HEK293T lysate) and vSX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: CHX10 Antibody [NBP1-84476] - Staining of human oral mucosa shows moderate nuclear(nucleolar) positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHX10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAH
Marker
pan-Bipolar Cell Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VSX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 28440470).
Control Peptide
CHX10 Protein (NBP1-84476PEP)
Publications
Read Publications using
NBP1-84476 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23233783). Rat reactivity reported in scientific literature (PMID: 28440470)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHX10 Antibody

  • ceh-10 homeo domain containing homolog (C. elegans)
  • ceh-10 homeo domain containing homolog
  • ceh-10 homeodomain containing homolog (C. elegans)
  • Ceh-10 homeodomain-containing homolog
  • CHX10MCOPCB3
  • Homeobox protein CHX10
  • HOX10C elegans ceh-10 homeo domain-containing homolog
  • MCOP2
  • RET1
  • visual system homeobox 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NB100-56467
Species: Hu, Ca, Pm
Applications: WB
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
H00030813-R02
Species: Hu
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006496-M04
Species: Hu
Applications: WB, ELISA
NBP1-82478
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB1980
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP2-37619
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88639
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-84476
Species: Hu, Rt, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CHX10 Antibody (NBP1-84476)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(2)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for CHX10 Antibody (NBP1-84476) (0)

There are no reviews for CHX10 Antibody (NBP1-84476). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHX10 Antibody (NBP1-84476) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHX10 Products

Bioinformatics Tool for CHX10 Antibody (NBP1-84476)

Discover related pathways, diseases and genes to CHX10 Antibody (NBP1-84476). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHX10 Antibody (NBP1-84476)

Discover more about diseases related to CHX10 Antibody (NBP1-84476).
 

Pathways for CHX10 Antibody (NBP1-84476)

View related products by pathway.

PTMs for CHX10 Antibody (NBP1-84476)

Learn more about PTMs related to CHX10 Antibody (NBP1-84476).
 

Research Areas for CHX10 Antibody (NBP1-84476)

Find related products by research area.

Blogs on CHX10

There are no specific blogs for CHX10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHX10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VSX2
Entrez
Uniprot