CHX10 Antibody

Western Blot: CHX10 Antibody [NBP1-84476] - Analysis in control (vector only transfected HEK293T lysate) and vSX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: CHX10 Antibody [NBP1-84476] - Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.

Immunohistochemistry-Paraffin: CHX10 Antibody [NBP1-84476] - Staining of human retina shows strong nuclear positivity in inner nuclear layer.

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CHX10 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAH
• Marker: pan-Bipolar Cell Marker
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: VSX2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID 28440470).
• Control Peptide:

  CHX10 Protein (NBP1-84476PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23233783). Rat reactivity reported in scientific literature (PMID: 28440470)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CHX10 Antibody

• ceh-10 homeo domain containing homolog (C. elegans)
• ceh-10 homeo domain containing homolog
• ceh-10 homeodomain containing homolog (C. elegans)
• Ceh-10 homeodomain-containing homolog
• CHX10MCOPCB3
• Homeobox protein CHX10
• HOX10C elegans ceh-10 homeo domain-containing homolog
• MCOP2
• RET1
• visual system homeobox 2

Background

The CHX10 gene encodes a homeobox protein originally described as a retina-specific transcription factor. Mutations in thisgene are associated with microphthalmia, cataracts and iris abnormalities. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CHX10 Antibody (NBP1-84476)(6)

Publications using NBP1-84476

• Xu Z, Bai S, Wu H, Fang M Elevated retinal retinol-binding protein 4 levels in diabetic mice can induce retinal neurodegeneration through microglia Microscopy research and technique 2022-11-10 [PMID: 36354743]
• Ke Y, Fan X, Hao R, et al. Human embryonic stem cell-derived extracellular vesicles alleviate retinal degeneration by upregulating Oct4 to promote retinal Müller cell retrodifferentiation via HSP90 Stem cell research & therapy 2021-01-07 [PMID: 33413616] (ICC/IF)
• Ho R, Workman MJ, Mathkar P et al. Cross-Comparison of Human iPSC Motor Neuron Models of Familial and Sporadic ALS Reveals Early and Convergent Transcriptomic Disease Signatures Cell systems 2020-12-23 [PMID: 33382996]
• Shrestha R, Wen YT, Ding DC, Tsai RK et al. Aberrant hiPSCs-Derived from Human Keratinocytes Differentiates into 3D Retinal Organoids that Acquire Mature Photoreceptors. Cells. 2019-03-09 [PMID: 30634512] (ICC/IF, Human)
• Li Y, He X, Li J et al. Proliferation and differentiation of direct co-culture of bone marrow mesenchymal stem cells and pigmented cells from the ciliary margin Mol Med Rep 2017-01-01 [PMID: 28440470] (ICC/IF, Rat)
• Bejjani A, Choi MR, Cassidy L et al. RB116: An RB1+ retinoblastoma cell line expressing primitive markers. Mol Vis 2012-01-01 [PMID: 23233783] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: VSX2
• Entrez:
  • 338917(Human)
• Uniprot:
  • P58304(Human)