Home » CHX10 » CHX10 Antibodies » CHX10 Antibody

CHX10 Antibody

 (3 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CHX10 Antibody [NBP1-84476] - Analysis in control (vector only transfected HEK293T lysate) and vSX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: CHX10 Antibody [NBP1-84476] - Analysis in control (vector only transfected HEK293T lysate) and vSX2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: CHX10 Antibody [NBP1-84476] - Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.
Immunohistochemistry-Paraffin: CHX10 Antibody [NBP1-84476] - Staining of human retina shows strong nuclear positivity in inner nuclear layer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CHX10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAH
Marker
pan-Bipolar Cell Marker
Specificity
Specificity of human CHX10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VSX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID 28440470).
Control Peptide
CHX10 Protein (NBP1-84476PEP)
Publications
Read Publications using
NBP1-84476 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23233783). Rat reactivity reported in scientific literature (PMID: 28440470)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHX10 Antibody

  • ceh-10 homeo domain containing homolog (C. elegans)
  • ceh-10 homeo domain containing homolog
  • ceh-10 homeodomain containing homolog (C. elegans)
  • Ceh-10 homeodomain-containing homolog
  • CHX10MCOPCB3
  • Homeobox protein CHX10
  • HOX10C elegans ceh-10 homeo domain-containing homolog
  • MCOP2
  • RET1
  • visual system homeobox 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Pax6 Antibody
NB300-750
Western Blot: Pax6 Antibody [NB300-750] - Analysis of sheep retinal extract
Immunocytochemistry/Immunofluorescence: Pax6 Antibody [NB300-750] - ARPE-19 monolayer on glass substrate. Fixative Methanol Blocking Goat Serum. Dilution 1:100. Incubation 1h @ RT. This image was submitted via customer Review.
Western Blot: Pax6 Antibody [NB300-750] - Analysis of rat whole eye extract
(4 Reviews)
(4 Publications)
Species: Hu, Mu, Rt, Fi, Pm, Pm, Sh
Applications: WB, ICC/IF, IHC, IP
RAX Antibody
NB100-56467
Western Blot: RAX Antibody [NB100-56467] - analysis of Rax in the 1) absence and 2) presence of immunizing peptide in Jurkat cell lysate using this antibody. 5 ug/ml.
Species: Hu, Ca, Pm
Applications: WB
Nestin Antibody
(196908)
MAB1259
Nestin was detected in immersion fixed human fetal neural progenitor cells using 10 µg/mL Human Nestin Monoclonal Antibody (Catalog # MAB1259) for 3 hours at room temperature. Cells were stained (green) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(5 Reviews)
(67 Publications)
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
VSX1 Antibody
NBP3-05676
VSX1 Antibody
Species: Hu
Applications: WB
Otx2 Antibody
[Unconjugated]
AF1979
Otx2 was detected in immersion fixed NTera‑2 human testicular embryonic carcinoma cell line using Goat Anti-Human Otx2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1979) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Otx2 was detected in immersion fixed paraffin-embedded sections of mouse embryo (14 d.p.c.) using Goat Anti-Human Otx2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1979) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to developing nervous system. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Simple Western lane view shows lysates of IMR‑32 human neuroblastoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Otx2 at approximately 48 kDa (as indicated) using 10 µg/mL of Goat Anti-Human Otx2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1979) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(6 Reviews)
(37 Publications)
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Sonic Hedgehog/Shh
[Unconjugated]
1845-SH
1 μg/lane of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 22 kDa.
MALDI-TOF analysis of Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus. The major peak corresponds to the calculated molecular mass, 19814 Da. The minor peak at 20029  is a matrix-associated artifact of the MALDI-TOF.
Recombinant Human Sonic Hedgehog/Shh (C24II), N-Terminus (Catalog # 1845-SH) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.1‑0.4 μg/mL.
(5 Reviews)
(37 Publications)
Species: Hu
MITF Antibody
(21D1418)
NB100-56561
Western Blot: MITF Antibody (21D1418) [NB100-56561] - Analysis of A375 lysate using MITF antibody at 4 ug/ml.
Immunocytochemistry/Immunofluorescence: MITF Antibody (21D1418) [NB100-56561] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-MITF Antibody (21D1418) NB100-56561 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution for 60 minutes. Cells were imaged using a 100X objective and digitally deconvolved.
Immunohistochemistry-Paraffin: MITF Antibody (21D1418) [NB100-56561] - Analysis of a FFPE tissue section of human skin using 1:200 dilution of MITF (21D1418) antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. General cytoplasmic staining appears enriched in melanocytes below the epidermis. Some nuclear reactivity is observed as well.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
SOX2 Antibody
(245610) [Unconjugate
MAB2018
Simple Western lane view shows lysates of BG01V human embryonic stem cells, loaded at 0.2 mg/mL. A specific band was detected for SOX2 at approximately 50 kDa (as indicated) using 4 µg/mL of Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of NTera‑2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, D3 mouse embryonic stem cell line, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
E‑Cadherin and SOX2 were detected in BG01V human embryonic stem cells using 10 µg/mL Goat Anti-Human E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF648) and 10 µg/mL Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018). Cells were incubated with primary antibodies for 3 hours at room temperature. Cells were stained for E‑Cadherin using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and for SOX2 using the NorthernLights 493-conjugated Anti-Mouse Secondary Antibody (green; Catalog # NL009). Cells were counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(12 Reviews)
(121 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
Rhodopsin Antibody
(1D4)
NBP1-47602
Western Blot: Rhodopsin Antibody (1D4) [NBP1-47602] - Analysis of Human Cell lysates showing detection of Rhodopsin protein using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 1D4. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (1D4) [NBP1-47602] - Analysis using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 1D4. Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: Dull epidermal staining.
(3 Publications)
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
SIX3 Antibody
NBP2-57249
Immunocytochemistry/Immunofluorescence: Six3 Antibody [NBP2-57249] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF
SIX6 Antibody
NBP1-82478
Western Blot: SIX6 Antibody [NBP1-82478] - Analysis in control (vector only transfected HEK293T lysate) and SIX6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: SIX6 Antibody [NBP1-82478] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SIX6 Antibody [NBP1-82478] - Staining of human retina, inner nuclear layer, shows moderate nuclear positivity.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RPE Antibody
NBP1-56853
Western Blot: RPE Antibody [NBP1-56853] - Human Muscle lysate, concentration 0.2-1 ug/ml.
Immunocytochemistry/Immunofluorescence: RPE Antibody [NBP1-56853] - Antibody 0 Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm but only in connective tissue cells in the interlobular septum, very low tissue distribution Primary Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
Recoverin Protein
NBC1-18499
SDS-Page: Recombinant Human Recoverin Protein [NBC1-18499] - Recoverin, 23 kDa (200 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE
SDS-Page: Recombinant Human Recoverin Protein [NBC1-18499] - 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.
Species: Hu
PKR Antibody
(HL71/10) [Unconjugat
MAB1980
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and HEK293 human embryonic kidney cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human PKR Monoclonal Antibody (Catalog # MAB1980) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for PKR at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of K562 human chronic myelogenous leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for PKR at approximately 73 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human PKR Monoclonal Antibody (Catalog # MAB1980). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
PKR was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line stimulated with rhIFN-alpha (Catalog # 11110-1) using Mouse Anti-Human PKR Monoclonal Antibody (Catalog # MAB1980) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(4 Publications)
Species: Hu
Applications: WB, Simple Western, IP, ICC
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(21 Reviews)
(458 Publications)
Species: Hu
p27/Kip1 [p
Thr157] Antibody
AF1555
Western blot shows lysates of MCF-7 human breast cancer cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF-I (Catalog # 291‑G1) for 20 minutes. PVDF membrane was probed with 0.5 µg/mL Human Phospho-p27/Kip1 (T157) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1555) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band for Phospho-p27/Kip1 (T157) was detected at approximately 27 kDa (as indicated). The phospho-specificity of this antibody was supported by decreased labeling following treatment with 600 U lambda -phosphatase ( lambda -PPase) for 1 hour. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(12 Publications)
Species: Hu
Applications: WB
LHX2 Antibody
(CL6137)
NBP2-61435
Western Blot: LHX2 Antibody (CL6137) [NBP2-61435] - Analysis in human cerebral cortex tissue.
Immunohistochemistry-Paraffin: LHX2 Antibody (CL6137) [NBP2-61435] - Staining of mouse embryo E14 shows strong nuclear immunoreactivity in the developing cortex and sensory organs.
Western Blot: LHX2 Antibody (CL6137) [NBP2-61435] - Analysis in mouse cerebral cortex tissue.
Species: Hu, Mu
Applications: WB, IHC, IHC-P
GFAP Antibody
NB300-141
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Analysis of mixed neuron-glial cultures using GFAP antibody NB300-141 (red) and Vimentin antibody NB300-223 (green). The fibroblastic cells contain only Vimentin and so are green. The astrocytes contain either Vimentin and GFAP (appearing golden) or predominantly GFAP (appearing red). Blue is nuclear DNA stain.
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Rat neurons stained with Neurofilament Heavy antibody NB300-217 (red) and GFAP antibody NB300-141 (green).
Immunocytochemistry/Immunofluorescence: GFAP Antibody [NB300-141] - Xenografted mouse brain section: astocyte and human nuclei. ICC/IF image submitted by a verified customer review.
(12 Reviews)
(59 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
ATOH7 Antibody
NBP1-88639
Immunocytochemistry/Immunofluorescence: ATOH7 Antibody [NBP1-88639] - Differential Notch-mediated regulation of Atoh7 transcription. Colocalization of transient mCherry transgenic expression, driven by a 2.4 kb mouse Atoh7 enhancer, to endogenous Atoh7 protein in the E13.5 retina (White arrows point to colabeled cells). Both cytoplasmic and nuclear Cherry expression are seen, presumably due to the inefficiency of a synthetic nuclear localization sequence and reporter antibody sensitivity, which detected both nascent Cherry protein in the cytoplasm and its accumulation in the nucleus. Scale bar = 100 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-28420-y), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: ATOH7 Antibody [NBP1-88639] - Staining of mouse embryo E14 shows moderate to strong nuclear positivity in a subset of cells in the developing eye retina.
Immunohistochemistry-Paraffin: ATOH7 Antibody [NBP1-88639] - Staining of human eye shows weak to moderate nuclear positivity in the outer nuclear layer of retina.
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
CHX10 Antibody
NBP1-84476
CHX10 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CHX10 Antibody (NBP1-84476)(3)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(3)
All Applications
Filter By Species
Human
(2)
Rat
(1)
All Species

Reviews for CHX10 Antibody (NBP1-84476) (0)

There are no reviews for CHX10 Antibody (NBP1-84476). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHX10 Antibody (NBP1-84476) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional CHX10 Products

Bioinformatics Tool for CHX10 Antibody (NBP1-84476)

Discover related pathways, diseases and genes to CHX10 Antibody (NBP1-84476). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHX10 Antibody (NBP1-84476)

Discover more about diseases related to CHX10 Antibody (NBP1-84476).
 

Pathways for CHX10 Antibody (NBP1-84476)

View related products by pathway.

PTMs for CHX10 Antibody (NBP1-84476)

Learn more about PTMs related to CHX10 Antibody (NBP1-84476).
 

Research Areas for CHX10 Antibody (NBP1-84476)

Find related products by research area.

Blogs on CHX10

There are no specific blogs for CHX10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHX10 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol VSX2
Entrez
Uniprot